Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UTB7

Protein Details
Accession A0A397UTB7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKKKEKRSGKVIKQKKKKVDFFYTWNHydrophilic
NLS Segment(s)
PositionSequence
2-18KKKEKRSGKVIKQKKKK
Subcellular Location(s) nucl 15, mito_nucl 12, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MKKKEKRSGKVIKQKKKKVDFFYTWNREYDQQKKFSFFYFYLSTKVKLAGNCDKKRKLDFSFIPGTSNYDWNLRLKKKDLELAGNAIKKVPRIITKCVVSNMKKIMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.91
4 0.89
5 0.87
6 0.86
7 0.81
8 0.78
9 0.79
10 0.76
11 0.68
12 0.6
13 0.53
14 0.49
15 0.49
16 0.51
17 0.46
18 0.46
19 0.46
20 0.48
21 0.47
22 0.43
23 0.41
24 0.32
25 0.3
26 0.27
27 0.26
28 0.27
29 0.27
30 0.26
31 0.22
32 0.23
33 0.21
34 0.17
35 0.22
36 0.27
37 0.36
38 0.41
39 0.48
40 0.5
41 0.51
42 0.53
43 0.53
44 0.47
45 0.45
46 0.41
47 0.4
48 0.42
49 0.4
50 0.38
51 0.32
52 0.32
53 0.24
54 0.24
55 0.19
56 0.15
57 0.16
58 0.2
59 0.27
60 0.29
61 0.32
62 0.35
63 0.39
64 0.41
65 0.45
66 0.44
67 0.41
68 0.39
69 0.41
70 0.42
71 0.39
72 0.35
73 0.32
74 0.29
75 0.25
76 0.26
77 0.26
78 0.29
79 0.31
80 0.38
81 0.44
82 0.47
83 0.5
84 0.54
85 0.57
86 0.52
87 0.54