Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397UGP2

Protein Details
Accession A0A397UGP2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-99IEVGKRKAVPYKQRRKARPKKAKKVKPRRNPIBasic
NLS Segment(s)
PositionSequence
71-99GKRKAVPYKQRRKARPKKAKKVKPRRNPI
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVNDQNHSYIDKHDSSSSTQIFGLDEQNAKLERELEDLDKCVDRDTVVDLIHEIVPLLLIIKRKVEIIEVGKRKAVPYKQRRKARPKKAKKVKPRRNPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.34
4 0.31
5 0.27
6 0.25
7 0.23
8 0.21
9 0.2
10 0.19
11 0.14
12 0.14
13 0.13
14 0.15
15 0.16
16 0.16
17 0.15
18 0.14
19 0.12
20 0.14
21 0.15
22 0.15
23 0.15
24 0.15
25 0.16
26 0.16
27 0.15
28 0.13
29 0.12
30 0.09
31 0.09
32 0.1
33 0.11
34 0.1
35 0.1
36 0.09
37 0.1
38 0.1
39 0.09
40 0.07
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.07
47 0.08
48 0.09
49 0.09
50 0.1
51 0.1
52 0.11
53 0.14
54 0.18
55 0.27
56 0.3
57 0.31
58 0.33
59 0.33
60 0.33
61 0.36
62 0.39
63 0.41
64 0.48
65 0.58
66 0.66
67 0.76
68 0.85
69 0.89
70 0.91
71 0.92
72 0.92
73 0.92
74 0.94
75 0.95
76 0.96
77 0.96
78 0.96
79 0.96