Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397W5I1

Protein Details
Accession A0A397W5I1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKFWKSREKKKSIRLGLRSTIRRHydrophilic
NLS Segment(s)
PositionSequence
7-16REKKKSIRLG
Subcellular Location(s) nucl 24, cyto_nucl 14.333, mito_nucl 13.499
Family & Domain DBs
Amino Acid Sequences MKFWKSREKKKSIRLGLRSTIRRENDLPKRRDSICSGGKKYEENLDDTCRLWLLRVKNHMNSKEVKRIKDAQSNCAMDRNSNENPKPKSSGKDDRKLVKSCCNMANKSTQEENSSDSTELMLQMGDDVGRIFLYANRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.81
4 0.81
5 0.77
6 0.72
7 0.7
8 0.62
9 0.59
10 0.56
11 0.58
12 0.59
13 0.63
14 0.61
15 0.57
16 0.6
17 0.57
18 0.57
19 0.52
20 0.5
21 0.49
22 0.53
23 0.51
24 0.49
25 0.49
26 0.46
27 0.42
28 0.41
29 0.33
30 0.28
31 0.27
32 0.27
33 0.27
34 0.26
35 0.25
36 0.18
37 0.16
38 0.14
39 0.16
40 0.17
41 0.21
42 0.28
43 0.32
44 0.38
45 0.45
46 0.46
47 0.44
48 0.45
49 0.45
50 0.47
51 0.47
52 0.42
53 0.4
54 0.45
55 0.47
56 0.49
57 0.45
58 0.4
59 0.43
60 0.44
61 0.39
62 0.37
63 0.32
64 0.25
65 0.26
66 0.27
67 0.24
68 0.29
69 0.32
70 0.35
71 0.38
72 0.4
73 0.43
74 0.4
75 0.41
76 0.43
77 0.51
78 0.52
79 0.58
80 0.62
81 0.65
82 0.69
83 0.7
84 0.64
85 0.62
86 0.59
87 0.54
88 0.55
89 0.53
90 0.48
91 0.45
92 0.5
93 0.43
94 0.44
95 0.43
96 0.37
97 0.34
98 0.33
99 0.34
100 0.28
101 0.28
102 0.23
103 0.2
104 0.19
105 0.16
106 0.15
107 0.12
108 0.09
109 0.06
110 0.06
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06