Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397UH28

Protein Details
Accession A0A397UH28    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
239-262VVRPSSKGLDKRKIRSKTARAMLTHydrophilic
NLS Segment(s)
PositionSequence
250-251RK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR003029  S1_domain  
IPR036860  SH2_dom_sf  
IPR042066  Spt6_death-like  
IPR035420  Spt6_SH2  
IPR017072  TF_Spt6  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF14633  SH2_2  
PROSITE View protein in PROSITE  
PS50126  S1  
Amino Acid Sequences MDDDEAEEELQQSNRRDFLRKLSAEPDRLNDLILEDYAKSLSKYYELPTKLILHNIKTEMMAPYADPRRPFEIPTPAKIFEIITGETEETLYEGLIVCVKIYKIEDKALKCQLDSGLYGTITIGYVADHRIESQELRSRFHIDQQIYAKILSIDKIKFSIFCYSELPSEGKQTFQSQRSVYSDYDYDAEARAQTLKQVKPRNVLTHKPHTRVIQHPMFKPFTFAEAQDYLRDKQSGSMVVRPSSKGLDKRKIRSKTARAMLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.36
4 0.37
5 0.44
6 0.48
7 0.47
8 0.48
9 0.51
10 0.56
11 0.57
12 0.56
13 0.5
14 0.45
15 0.43
16 0.39
17 0.31
18 0.25
19 0.19
20 0.17
21 0.14
22 0.09
23 0.1
24 0.1
25 0.11
26 0.1
27 0.1
28 0.11
29 0.12
30 0.14
31 0.17
32 0.24
33 0.25
34 0.26
35 0.28
36 0.32
37 0.31
38 0.36
39 0.36
40 0.3
41 0.33
42 0.33
43 0.31
44 0.26
45 0.27
46 0.2
47 0.18
48 0.15
49 0.12
50 0.17
51 0.22
52 0.24
53 0.24
54 0.26
55 0.31
56 0.32
57 0.34
58 0.32
59 0.38
60 0.39
61 0.43
62 0.44
63 0.39
64 0.38
65 0.36
66 0.31
67 0.22
68 0.21
69 0.16
70 0.12
71 0.12
72 0.12
73 0.11
74 0.11
75 0.09
76 0.06
77 0.06
78 0.05
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.08
89 0.11
90 0.12
91 0.17
92 0.22
93 0.24
94 0.29
95 0.34
96 0.33
97 0.3
98 0.3
99 0.25
100 0.22
101 0.2
102 0.16
103 0.11
104 0.1
105 0.1
106 0.09
107 0.08
108 0.06
109 0.06
110 0.04
111 0.03
112 0.04
113 0.04
114 0.05
115 0.05
116 0.05
117 0.06
118 0.07
119 0.07
120 0.1
121 0.16
122 0.16
123 0.18
124 0.19
125 0.23
126 0.23
127 0.28
128 0.3
129 0.25
130 0.29
131 0.3
132 0.3
133 0.26
134 0.26
135 0.21
136 0.16
137 0.15
138 0.12
139 0.13
140 0.12
141 0.12
142 0.13
143 0.13
144 0.13
145 0.14
146 0.2
147 0.17
148 0.18
149 0.19
150 0.2
151 0.2
152 0.21
153 0.21
154 0.15
155 0.19
156 0.18
157 0.17
158 0.17
159 0.22
160 0.27
161 0.27
162 0.32
163 0.27
164 0.31
165 0.34
166 0.35
167 0.3
168 0.27
169 0.24
170 0.2
171 0.21
172 0.17
173 0.14
174 0.11
175 0.11
176 0.09
177 0.09
178 0.1
179 0.09
180 0.13
181 0.2
182 0.23
183 0.31
184 0.4
185 0.44
186 0.49
187 0.55
188 0.6
189 0.6
190 0.65
191 0.65
192 0.68
193 0.71
194 0.67
195 0.66
196 0.62
197 0.62
198 0.59
199 0.6
200 0.58
201 0.56
202 0.57
203 0.59
204 0.58
205 0.51
206 0.49
207 0.4
208 0.35
209 0.31
210 0.26
211 0.25
212 0.24
213 0.25
214 0.26
215 0.29
216 0.27
217 0.29
218 0.29
219 0.24
220 0.24
221 0.27
222 0.29
223 0.28
224 0.33
225 0.33
226 0.36
227 0.39
228 0.37
229 0.35
230 0.34
231 0.38
232 0.41
233 0.47
234 0.53
235 0.6
236 0.69
237 0.76
238 0.79
239 0.81
240 0.83
241 0.83
242 0.83