Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395P012

Protein Details
Accession A0A395P012    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-38QRRACDACYKRKCDRSEPDEHydrophilic
46-73HDLPCTLNRIRGRKKKTKSSTESIVKRLHydrophilic
NLS Segment(s)
PositionSequence
56-63RGRKKKTK
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, mito 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007219  Transcription_factor_dom_fun  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF04082  Fungal_trans  
CDD cd12148  fungal_TF_MHR  
cd00067  GAL4  
Amino Acid Sequences MDVSNLPEKAKAQQRMAAQRRACDACYKRKCDRSEPDEQCNWCRHHDLPCTLNRIRGRKKKTKSSTESIVKRLERIEEGIARAKALKQGIQIAPAAPAAPAAPAAASPDSTAPSDGSGSFQRKVSHGRQLSATPLGQVWFSGQKFAAICSRNGIPHFTSLGEQWIYSQTGLWPRFHNEDTFALCEAADRVPSGALSLKSLKGQAKQAQIGKLTEKWVVHALLDAFNKSDFRLIFPVVDRRLFEETIRQAYDSPDTNPTIEQVGSKACVLAFASVASHHFCALEISKLVDSDACAKQAQILISDFIEDASLTTLQVMVMLLLHETLCGHLQAACMYHAIACRTVCVLGGHALASDPPDDHNLTVQELEERQIRLLFWLCYLFDKDMALRNGQPPIMSDEFCDLTLPKEYLENRFSPQALSGTGETQRPFLPNDLRLSLLKSKAVSALYSAGSLRKSDAELLRTIRELDEDLETWRASIPAEYAPALSVRKHVKLADIPNQTTGMLHIELHLDYHYLLNVIHCASGRCVVDWSESGKEMIFGLQSSLDLSVEASRSTLIYLSEAAPRLAGEAFWVFIFYPVSALLKLLASSTKVIRSMPISRVTAHELEYLRKMDAFIEELGRLSQAAIAKVQNENRGAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.68
4 0.69
5 0.62
6 0.59
7 0.62
8 0.61
9 0.54
10 0.53
11 0.53
12 0.55
13 0.62
14 0.65
15 0.67
16 0.72
17 0.77
18 0.77
19 0.8
20 0.77
21 0.78
22 0.78
23 0.77
24 0.76
25 0.74
26 0.69
27 0.66
28 0.61
29 0.54
30 0.51
31 0.46
32 0.47
33 0.52
34 0.53
35 0.53
36 0.56
37 0.6
38 0.56
39 0.6
40 0.58
41 0.6
42 0.64
43 0.67
44 0.71
45 0.73
46 0.82
47 0.86
48 0.89
49 0.9
50 0.87
51 0.85
52 0.86
53 0.85
54 0.82
55 0.77
56 0.75
57 0.65
58 0.59
59 0.54
60 0.47
61 0.39
62 0.36
63 0.35
64 0.3
65 0.32
66 0.36
67 0.34
68 0.31
69 0.3
70 0.28
71 0.28
72 0.26
73 0.26
74 0.22
75 0.3
76 0.3
77 0.31
78 0.31
79 0.26
80 0.25
81 0.22
82 0.2
83 0.11
84 0.1
85 0.08
86 0.07
87 0.07
88 0.05
89 0.05
90 0.05
91 0.08
92 0.08
93 0.08
94 0.09
95 0.1
96 0.12
97 0.12
98 0.13
99 0.11
100 0.11
101 0.12
102 0.12
103 0.14
104 0.18
105 0.21
106 0.23
107 0.25
108 0.26
109 0.28
110 0.35
111 0.38
112 0.42
113 0.41
114 0.42
115 0.42
116 0.42
117 0.43
118 0.39
119 0.33
120 0.24
121 0.21
122 0.19
123 0.16
124 0.14
125 0.13
126 0.16
127 0.16
128 0.17
129 0.16
130 0.19
131 0.19
132 0.21
133 0.25
134 0.2
135 0.21
136 0.22
137 0.24
138 0.24
139 0.25
140 0.27
141 0.21
142 0.22
143 0.23
144 0.2
145 0.19
146 0.17
147 0.19
148 0.16
149 0.15
150 0.13
151 0.14
152 0.14
153 0.13
154 0.13
155 0.12
156 0.2
157 0.22
158 0.23
159 0.23
160 0.26
161 0.31
162 0.32
163 0.3
164 0.25
165 0.26
166 0.27
167 0.26
168 0.23
169 0.19
170 0.17
171 0.16
172 0.14
173 0.12
174 0.09
175 0.08
176 0.07
177 0.07
178 0.07
179 0.08
180 0.1
181 0.09
182 0.12
183 0.14
184 0.15
185 0.16
186 0.2
187 0.22
188 0.22
189 0.29
190 0.33
191 0.36
192 0.41
193 0.43
194 0.43
195 0.42
196 0.4
197 0.36
198 0.32
199 0.28
200 0.27
201 0.23
202 0.21
203 0.21
204 0.2
205 0.17
206 0.17
207 0.15
208 0.16
209 0.17
210 0.15
211 0.13
212 0.13
213 0.14
214 0.12
215 0.14
216 0.1
217 0.12
218 0.14
219 0.15
220 0.16
221 0.18
222 0.24
223 0.22
224 0.24
225 0.22
226 0.22
227 0.25
228 0.24
229 0.22
230 0.22
231 0.23
232 0.25
233 0.25
234 0.22
235 0.2
236 0.2
237 0.23
238 0.18
239 0.17
240 0.16
241 0.17
242 0.17
243 0.16
244 0.16
245 0.14
246 0.13
247 0.11
248 0.09
249 0.09
250 0.09
251 0.09
252 0.09
253 0.07
254 0.07
255 0.07
256 0.07
257 0.06
258 0.05
259 0.06
260 0.06
261 0.07
262 0.07
263 0.07
264 0.07
265 0.07
266 0.06
267 0.08
268 0.08
269 0.09
270 0.08
271 0.09
272 0.09
273 0.09
274 0.09
275 0.07
276 0.07
277 0.11
278 0.12
279 0.12
280 0.12
281 0.12
282 0.13
283 0.15
284 0.15
285 0.11
286 0.1
287 0.1
288 0.1
289 0.1
290 0.09
291 0.07
292 0.06
293 0.05
294 0.04
295 0.05
296 0.05
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.03
304 0.03
305 0.03
306 0.03
307 0.03
308 0.03
309 0.03
310 0.03
311 0.04
312 0.04
313 0.04
314 0.04
315 0.05
316 0.05
317 0.06
318 0.07
319 0.07
320 0.06
321 0.06
322 0.07
323 0.08
324 0.08
325 0.1
326 0.09
327 0.09
328 0.09
329 0.09
330 0.09
331 0.08
332 0.08
333 0.07
334 0.08
335 0.07
336 0.07
337 0.06
338 0.06
339 0.06
340 0.06
341 0.05
342 0.05
343 0.07
344 0.08
345 0.08
346 0.1
347 0.1
348 0.1
349 0.1
350 0.1
351 0.09
352 0.09
353 0.1
354 0.11
355 0.11
356 0.11
357 0.11
358 0.11
359 0.12
360 0.14
361 0.12
362 0.1
363 0.11
364 0.11
365 0.12
366 0.13
367 0.12
368 0.1
369 0.11
370 0.11
371 0.16
372 0.17
373 0.17
374 0.17
375 0.19
376 0.2
377 0.2
378 0.19
379 0.14
380 0.19
381 0.19
382 0.17
383 0.16
384 0.16
385 0.17
386 0.17
387 0.16
388 0.1
389 0.1
390 0.12
391 0.11
392 0.09
393 0.13
394 0.14
395 0.19
396 0.22
397 0.23
398 0.23
399 0.25
400 0.25
401 0.21
402 0.21
403 0.17
404 0.14
405 0.14
406 0.13
407 0.13
408 0.14
409 0.16
410 0.15
411 0.16
412 0.16
413 0.16
414 0.16
415 0.19
416 0.21
417 0.23
418 0.26
419 0.25
420 0.26
421 0.25
422 0.28
423 0.29
424 0.26
425 0.24
426 0.21
427 0.21
428 0.22
429 0.22
430 0.18
431 0.14
432 0.15
433 0.13
434 0.14
435 0.13
436 0.12
437 0.12
438 0.13
439 0.12
440 0.11
441 0.11
442 0.16
443 0.19
444 0.19
445 0.22
446 0.24
447 0.25
448 0.24
449 0.24
450 0.19
451 0.17
452 0.15
453 0.13
454 0.13
455 0.12
456 0.13
457 0.14
458 0.14
459 0.13
460 0.12
461 0.11
462 0.09
463 0.09
464 0.09
465 0.09
466 0.1
467 0.11
468 0.1
469 0.11
470 0.13
471 0.13
472 0.12
473 0.17
474 0.2
475 0.22
476 0.24
477 0.25
478 0.28
479 0.33
480 0.4
481 0.43
482 0.45
483 0.44
484 0.43
485 0.43
486 0.38
487 0.31
488 0.25
489 0.19
490 0.12
491 0.11
492 0.1
493 0.11
494 0.11
495 0.12
496 0.11
497 0.08
498 0.08
499 0.09
500 0.08
501 0.07
502 0.07
503 0.07
504 0.09
505 0.09
506 0.09
507 0.09
508 0.11
509 0.12
510 0.17
511 0.17
512 0.16
513 0.17
514 0.17
515 0.19
516 0.19
517 0.22
518 0.19
519 0.19
520 0.19
521 0.17
522 0.17
523 0.14
524 0.14
525 0.11
526 0.08
527 0.09
528 0.08
529 0.08
530 0.09
531 0.09
532 0.08
533 0.07
534 0.08
535 0.09
536 0.09
537 0.09
538 0.09
539 0.09
540 0.09
541 0.09
542 0.1
543 0.08
544 0.08
545 0.1
546 0.12
547 0.16
548 0.17
549 0.16
550 0.15
551 0.15
552 0.15
553 0.13
554 0.11
555 0.1
556 0.09
557 0.1
558 0.09
559 0.1
560 0.09
561 0.1
562 0.12
563 0.09
564 0.09
565 0.09
566 0.11
567 0.1
568 0.11
569 0.1
570 0.1
571 0.1
572 0.1
573 0.11
574 0.11
575 0.14
576 0.17
577 0.19
578 0.2
579 0.21
580 0.23
581 0.27
582 0.31
583 0.34
584 0.38
585 0.36
586 0.36
587 0.39
588 0.42
589 0.38
590 0.34
591 0.34
592 0.29
593 0.31
594 0.35
595 0.33
596 0.28
597 0.27
598 0.25
599 0.21
600 0.21
601 0.2
602 0.17
603 0.18
604 0.18
605 0.18
606 0.18
607 0.17
608 0.14
609 0.12
610 0.13
611 0.13
612 0.14
613 0.16
614 0.18
615 0.2
616 0.27
617 0.31
618 0.34
619 0.34