Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395NKC9

Protein Details
Accession A0A395NKC9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-69DENGRRKRWRRRDTVDAKDGBasic
NLS Segment(s)
PositionSequence
55-60RKRWRR
Subcellular Location(s) extr 7, plas 6, mito 4, golg 4, E.R. 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Amino Acid Sequences MPPHLHPRSRMTSSLFATTVIASFFVVALPHLLPCPVPRTKYADGEIIVDENGRRKRWRRRDTVDAKDGLVQFNQTTDDEIERAAERMTRECPVPKPGGMLGEWLGFHATDDKTRANR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.29
5 0.26
6 0.21
7 0.14
8 0.11
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.07
21 0.08
22 0.14
23 0.15
24 0.17
25 0.19
26 0.27
27 0.3
28 0.34
29 0.34
30 0.32
31 0.29
32 0.29
33 0.26
34 0.19
35 0.16
36 0.12
37 0.1
38 0.13
39 0.16
40 0.17
41 0.21
42 0.28
43 0.39
44 0.5
45 0.59
46 0.62
47 0.67
48 0.75
49 0.8
50 0.81
51 0.75
52 0.65
53 0.56
54 0.5
55 0.44
56 0.33
57 0.24
58 0.17
59 0.11
60 0.11
61 0.12
62 0.08
63 0.09
64 0.09
65 0.1
66 0.1
67 0.1
68 0.11
69 0.09
70 0.1
71 0.09
72 0.1
73 0.11
74 0.13
75 0.16
76 0.16
77 0.18
78 0.22
79 0.25
80 0.29
81 0.31
82 0.29
83 0.3
84 0.29
85 0.29
86 0.25
87 0.24
88 0.19
89 0.18
90 0.17
91 0.14
92 0.14
93 0.11
94 0.11
95 0.14
96 0.14
97 0.15
98 0.19