Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NI15

Protein Details
Accession A0A395NI15   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-47IAPVAKKTSRAPPKSQKKSQEQPPKAASHydrophilic
NLS Segment(s)
PositionSequence
25-56KKTSRAPPKSQKKSQEQPPKAASSSRKGRAGT
65-66KK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MPTRTRKRKASEEEDATPDIAPVAKKTSRAPPKSQKKSQEQPPKAASSSRKGRAGTSLSASNAAKKAKTGTSSVSSAKRDIRRKADDLIRLIESQYGSARSTDRPDSTDSSIVAILKDAADLASNSADVNQSAIDEYEDINKRSIDITKPADRRQWHQDAIDIANVEKKAIEMSLQVLNGVVLAGEYAKFLCSPARVGDEFEQAACRWLQGGMPAAEDTWGATARETMKAFAGITKLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.63
3 0.53
4 0.43
5 0.34
6 0.24
7 0.19
8 0.15
9 0.12
10 0.17
11 0.19
12 0.22
13 0.26
14 0.36
15 0.44
16 0.5
17 0.59
18 0.63
19 0.72
20 0.8
21 0.85
22 0.84
23 0.84
24 0.87
25 0.87
26 0.88
27 0.82
28 0.8
29 0.77
30 0.72
31 0.63
32 0.6
33 0.54
34 0.52
35 0.56
36 0.53
37 0.53
38 0.49
39 0.49
40 0.49
41 0.48
42 0.41
43 0.35
44 0.32
45 0.27
46 0.3
47 0.29
48 0.26
49 0.26
50 0.24
51 0.21
52 0.19
53 0.22
54 0.22
55 0.24
56 0.23
57 0.23
58 0.25
59 0.28
60 0.31
61 0.33
62 0.31
63 0.32
64 0.37
65 0.41
66 0.44
67 0.48
68 0.53
69 0.54
70 0.55
71 0.59
72 0.58
73 0.55
74 0.5
75 0.46
76 0.39
77 0.33
78 0.3
79 0.25
80 0.19
81 0.14
82 0.13
83 0.11
84 0.1
85 0.11
86 0.12
87 0.11
88 0.15
89 0.17
90 0.17
91 0.18
92 0.2
93 0.23
94 0.23
95 0.23
96 0.2
97 0.18
98 0.18
99 0.16
100 0.13
101 0.09
102 0.07
103 0.05
104 0.05
105 0.04
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.05
115 0.04
116 0.05
117 0.04
118 0.04
119 0.04
120 0.05
121 0.04
122 0.05
123 0.05
124 0.11
125 0.13
126 0.14
127 0.15
128 0.15
129 0.15
130 0.16
131 0.19
132 0.15
133 0.19
134 0.23
135 0.31
136 0.35
137 0.38
138 0.43
139 0.43
140 0.46
141 0.48
142 0.49
143 0.44
144 0.4
145 0.39
146 0.36
147 0.35
148 0.32
149 0.23
150 0.17
151 0.18
152 0.17
153 0.14
154 0.11
155 0.09
156 0.08
157 0.08
158 0.08
159 0.06
160 0.08
161 0.11
162 0.11
163 0.11
164 0.1
165 0.1
166 0.09
167 0.08
168 0.05
169 0.02
170 0.03
171 0.03
172 0.03
173 0.04
174 0.04
175 0.05
176 0.05
177 0.06
178 0.08
179 0.09
180 0.11
181 0.13
182 0.18
183 0.19
184 0.23
185 0.25
186 0.27
187 0.26
188 0.25
189 0.24
190 0.19
191 0.21
192 0.17
193 0.14
194 0.1
195 0.1
196 0.1
197 0.11
198 0.16
199 0.15
200 0.16
201 0.17
202 0.16
203 0.16
204 0.15
205 0.13
206 0.09
207 0.1
208 0.09
209 0.09
210 0.13
211 0.14
212 0.21
213 0.21
214 0.2
215 0.2
216 0.22
217 0.22
218 0.21
219 0.21