Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395N715

Protein Details
Accession A0A395N715    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-29HASPIKATPGRRRHPRGGKPAALKAYHydrophilic
66-90AQPGSKPRNRSHKPKGKNDPASPNYHydrophilic
NLS Segment(s)
PositionSequence
11-24TPGRRRHPRGGKPA
71-82KPRNRSHKPKGK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MEAHASPIKATPGRRRHPRGGKPAALKAYASENDAASYALSAHHRAPQTPKKILTASPAPADSLSAQPGSKPRNRSHKPKGKNDPASPNYHLSNSQSPPRTSPTSKAISSTPFAGATFHASPAPSDLPIPSFLKSSSESPMVRKPRGVIPQPSPPATDSELPTPHRPISANQHRESPLDFMFRAHREEKARQNFDSSTITASSVLAGAISPPRHLDTPLSPTSSNLSQGRRTYSRQASGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.77
4 0.84
5 0.87
6 0.88
7 0.87
8 0.86
9 0.82
10 0.81
11 0.75
12 0.65
13 0.55
14 0.46
15 0.43
16 0.35
17 0.31
18 0.24
19 0.2
20 0.19
21 0.19
22 0.18
23 0.1
24 0.09
25 0.07
26 0.08
27 0.1
28 0.11
29 0.13
30 0.18
31 0.19
32 0.22
33 0.31
34 0.38
35 0.44
36 0.49
37 0.49
38 0.48
39 0.5
40 0.48
41 0.46
42 0.42
43 0.37
44 0.34
45 0.32
46 0.28
47 0.25
48 0.25
49 0.19
50 0.15
51 0.13
52 0.12
53 0.11
54 0.13
55 0.18
56 0.23
57 0.27
58 0.32
59 0.38
60 0.48
61 0.54
62 0.63
63 0.69
64 0.73
65 0.77
66 0.81
67 0.85
68 0.84
69 0.87
70 0.83
71 0.82
72 0.76
73 0.73
74 0.65
75 0.58
76 0.48
77 0.4
78 0.35
79 0.28
80 0.31
81 0.27
82 0.3
83 0.31
84 0.31
85 0.32
86 0.36
87 0.37
88 0.33
89 0.34
90 0.34
91 0.35
92 0.34
93 0.33
94 0.3
95 0.27
96 0.26
97 0.23
98 0.17
99 0.13
100 0.13
101 0.12
102 0.1
103 0.12
104 0.11
105 0.11
106 0.1
107 0.1
108 0.1
109 0.11
110 0.12
111 0.08
112 0.08
113 0.07
114 0.08
115 0.11
116 0.12
117 0.1
118 0.11
119 0.1
120 0.12
121 0.14
122 0.15
123 0.15
124 0.18
125 0.18
126 0.21
127 0.29
128 0.32
129 0.32
130 0.31
131 0.31
132 0.33
133 0.4
134 0.42
135 0.4
136 0.39
137 0.47
138 0.49
139 0.48
140 0.42
141 0.35
142 0.33
143 0.3
144 0.28
145 0.21
146 0.22
147 0.25
148 0.27
149 0.29
150 0.29
151 0.27
152 0.26
153 0.26
154 0.25
155 0.32
156 0.39
157 0.44
158 0.43
159 0.48
160 0.47
161 0.47
162 0.45
163 0.38
164 0.29
165 0.25
166 0.24
167 0.2
168 0.25
169 0.25
170 0.29
171 0.26
172 0.29
173 0.32
174 0.39
175 0.48
176 0.53
177 0.55
178 0.52
179 0.55
180 0.5
181 0.48
182 0.44
183 0.35
184 0.27
185 0.23
186 0.23
187 0.18
188 0.17
189 0.14
190 0.1
191 0.09
192 0.06
193 0.05
194 0.06
195 0.1
196 0.11
197 0.12
198 0.13
199 0.17
200 0.18
201 0.19
202 0.23
203 0.23
204 0.3
205 0.34
206 0.36
207 0.33
208 0.33
209 0.37
210 0.34
211 0.36
212 0.33
213 0.34
214 0.37
215 0.41
216 0.48
217 0.48
218 0.51
219 0.54
220 0.58