Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NWE2

Protein Details
Accession A0A395NWE2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-47LQRRRSQLVASQRKRRAHKRLSQPSKPSSAAHydrophilic
NLS Segment(s)
PositionSequence
28-37QRKRRAHKRL
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MVKRGRPSLNLTPEERLQRRRSQLVASQRKRRAHKRLSQPSKPSSAATSGGQRPNVPVPNEALCQYYDAMFLGQDAEIAVSQHRGVAAASKTPSPDCHQSSLTVCHRYGSAPLDMATLTAAMSSSSPASLLWTAQLGTDAYALSSRLASPLRSSAGVDYTSANGPDNPGTDEDIFTEEHLMQTRSSMPPFALGVDSFDALDIDLDGGALLSEVDTRVSQQKCDAQATVATRIDNVFLPGLSGCANPESFWMPSSPPRTVSTLTGPMLSGPALCDESDDGVVDLLASWAGAKQVSLVGEAPRMLDSSRMAIRLLRLRANFTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.61
3 0.59
4 0.57
5 0.61
6 0.65
7 0.66
8 0.64
9 0.61
10 0.62
11 0.65
12 0.69
13 0.69
14 0.72
15 0.74
16 0.79
17 0.82
18 0.84
19 0.84
20 0.83
21 0.84
22 0.85
23 0.88
24 0.9
25 0.9
26 0.89
27 0.84
28 0.8
29 0.72
30 0.62
31 0.54
32 0.47
33 0.4
34 0.33
35 0.35
36 0.35
37 0.38
38 0.38
39 0.35
40 0.35
41 0.4
42 0.43
43 0.37
44 0.31
45 0.31
46 0.33
47 0.33
48 0.31
49 0.25
50 0.19
51 0.19
52 0.18
53 0.15
54 0.11
55 0.1
56 0.1
57 0.08
58 0.08
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.06
72 0.06
73 0.11
74 0.12
75 0.15
76 0.16
77 0.17
78 0.19
79 0.19
80 0.22
81 0.22
82 0.28
83 0.28
84 0.3
85 0.3
86 0.31
87 0.33
88 0.38
89 0.38
90 0.35
91 0.31
92 0.28
93 0.28
94 0.26
95 0.26
96 0.21
97 0.16
98 0.13
99 0.13
100 0.13
101 0.13
102 0.12
103 0.09
104 0.06
105 0.05
106 0.04
107 0.04
108 0.03
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.05
124 0.05
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.07
135 0.08
136 0.08
137 0.1
138 0.11
139 0.11
140 0.11
141 0.1
142 0.11
143 0.11
144 0.1
145 0.09
146 0.09
147 0.09
148 0.09
149 0.09
150 0.07
151 0.08
152 0.08
153 0.08
154 0.08
155 0.08
156 0.1
157 0.1
158 0.1
159 0.1
160 0.1
161 0.1
162 0.09
163 0.09
164 0.07
165 0.08
166 0.09
167 0.09
168 0.08
169 0.09
170 0.11
171 0.12
172 0.12
173 0.12
174 0.1
175 0.11
176 0.11
177 0.11
178 0.09
179 0.07
180 0.08
181 0.09
182 0.09
183 0.07
184 0.07
185 0.06
186 0.05
187 0.05
188 0.04
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.02
195 0.02
196 0.02
197 0.02
198 0.03
199 0.03
200 0.04
201 0.04
202 0.06
203 0.13
204 0.14
205 0.15
206 0.18
207 0.23
208 0.26
209 0.28
210 0.27
211 0.21
212 0.24
213 0.26
214 0.28
215 0.24
216 0.21
217 0.19
218 0.19
219 0.19
220 0.16
221 0.14
222 0.09
223 0.08
224 0.09
225 0.08
226 0.09
227 0.08
228 0.08
229 0.07
230 0.09
231 0.09
232 0.08
233 0.1
234 0.12
235 0.12
236 0.13
237 0.13
238 0.14
239 0.21
240 0.25
241 0.26
242 0.26
243 0.28
244 0.31
245 0.32
246 0.33
247 0.32
248 0.32
249 0.31
250 0.29
251 0.26
252 0.23
253 0.21
254 0.18
255 0.12
256 0.07
257 0.09
258 0.09
259 0.09
260 0.1
261 0.1
262 0.12
263 0.12
264 0.12
265 0.1
266 0.09
267 0.09
268 0.07
269 0.06
270 0.05
271 0.04
272 0.03
273 0.04
274 0.04
275 0.05
276 0.05
277 0.05
278 0.06
279 0.08
280 0.09
281 0.11
282 0.12
283 0.13
284 0.15
285 0.15
286 0.16
287 0.14
288 0.14
289 0.13
290 0.14
291 0.14
292 0.17
293 0.2
294 0.2
295 0.2
296 0.22
297 0.28
298 0.33
299 0.37
300 0.38
301 0.37