Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NX70

Protein Details
Accession A0A395NX70    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-75GPRAKISSKKARKLEKKMGYBasic
NLS Segment(s)
PositionSequence
9-80RASKNRLAARAAKAKKANQKLADPANRSKITKADKTRGARPGLLPTSGPRAKISSKKARKLEKKMGYALKRK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
Amino Acid Sequences MPSVKNPNRASKNRLAARAAKAKKANQKLADPANRSKITKADKTRGARPGLLPTSGPRAKISSKKARKLEKKMGYALKRKMEAEGEAEMKDAPVVEEKAAQEEEDVEIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.66
3 0.63
4 0.64
5 0.66
6 0.6
7 0.57
8 0.57
9 0.59
10 0.64
11 0.66
12 0.67
13 0.61
14 0.62
15 0.61
16 0.64
17 0.64
18 0.6
19 0.55
20 0.55
21 0.53
22 0.5
23 0.45
24 0.42
25 0.41
26 0.45
27 0.47
28 0.45
29 0.5
30 0.54
31 0.59
32 0.58
33 0.54
34 0.47
35 0.42
36 0.42
37 0.35
38 0.31
39 0.25
40 0.2
41 0.25
42 0.24
43 0.24
44 0.18
45 0.19
46 0.23
47 0.29
48 0.36
49 0.39
50 0.47
51 0.55
52 0.62
53 0.7
54 0.75
55 0.78
56 0.8
57 0.78
58 0.74
59 0.73
60 0.74
61 0.71
62 0.7
63 0.68
64 0.63
65 0.57
66 0.53
67 0.48
68 0.42
69 0.36
70 0.3
71 0.27
72 0.23
73 0.2
74 0.2
75 0.17
76 0.15
77 0.13
78 0.1
79 0.07
80 0.1
81 0.11
82 0.11
83 0.15
84 0.15
85 0.19
86 0.2
87 0.19
88 0.15
89 0.15