Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NMT8

Protein Details
Accession A0A395NMT8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-58KSAITSKSSKRKRSPTPSPPRPSKRQLHydrophilic
NLS Segment(s)
PositionSequence
24-56PPKGVKRLKSAITSKSSKRKRSPTPSPPRPSKR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MADSSSEETSGNSASPTATSAPPPPKGVKRLKSAITSKSSKRKRSPTPSPPRPSKRQLRLDSAVVEQMEKRLITRFDGMLTSLKKEIFDRLEVMEQKNDTMAQTTDEILEIVEDQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.1
4 0.11
5 0.11
6 0.14
7 0.2
8 0.26
9 0.28
10 0.32
11 0.36
12 0.4
13 0.47
14 0.55
15 0.55
16 0.57
17 0.6
18 0.61
19 0.62
20 0.61
21 0.59
22 0.56
23 0.54
24 0.54
25 0.58
26 0.62
27 0.63
28 0.67
29 0.7
30 0.73
31 0.78
32 0.82
33 0.82
34 0.85
35 0.87
36 0.86
37 0.87
38 0.84
39 0.81
40 0.79
41 0.78
42 0.76
43 0.76
44 0.72
45 0.69
46 0.65
47 0.59
48 0.52
49 0.43
50 0.35
51 0.25
52 0.21
53 0.14
54 0.11
55 0.11
56 0.09
57 0.09
58 0.1
59 0.11
60 0.13
61 0.15
62 0.15
63 0.15
64 0.15
65 0.16
66 0.18
67 0.18
68 0.18
69 0.17
70 0.17
71 0.17
72 0.18
73 0.22
74 0.2
75 0.21
76 0.2
77 0.21
78 0.27
79 0.3
80 0.31
81 0.3
82 0.27
83 0.26
84 0.25
85 0.23
86 0.17
87 0.17
88 0.15
89 0.13
90 0.14
91 0.14
92 0.13
93 0.13
94 0.13
95 0.1
96 0.1