Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LXH4

Protein Details
Accession E2LXH4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-112AKKPAVKKPAVKKPAVKKTAHydrophilic
NLS Segment(s)
PositionSequence
9-22GKKEEKGAKAFLAR
48-120GKLQTKAPAKAPAKAPAKAPAKAPAKAAAKPATKVAAKKPVTKAAAKKPAVKKPAVKKPAVKKTAAKKKPRSL
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
KEGG mpr:MPER_11979  -  
Amino Acid Sequences MYGPTESKGKKEEKGAKAFLARGKKFCRQASYWEKADFGKELALGKTGKLQTKAPAKAPAKAPAKAPAKAPAKAAAKPATKVAAKKPVTKAAAKKPAVKKPAVKKPAVKKTAAKKKPRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.62
3 0.59
4 0.58
5 0.57
6 0.53
7 0.53
8 0.48
9 0.46
10 0.5
11 0.53
12 0.57
13 0.58
14 0.59
15 0.51
16 0.58
17 0.6
18 0.6
19 0.57
20 0.5
21 0.46
22 0.4
23 0.4
24 0.3
25 0.21
26 0.15
27 0.12
28 0.13
29 0.12
30 0.14
31 0.12
32 0.11
33 0.16
34 0.19
35 0.2
36 0.21
37 0.22
38 0.26
39 0.34
40 0.36
41 0.33
42 0.39
43 0.38
44 0.4
45 0.41
46 0.43
47 0.39
48 0.38
49 0.36
50 0.36
51 0.39
52 0.36
53 0.34
54 0.34
55 0.34
56 0.34
57 0.34
58 0.33
59 0.32
60 0.33
61 0.36
62 0.34
63 0.33
64 0.32
65 0.33
66 0.3
67 0.3
68 0.3
69 0.32
70 0.35
71 0.36
72 0.42
73 0.45
74 0.49
75 0.5
76 0.54
77 0.55
78 0.56
79 0.63
80 0.59
81 0.64
82 0.64
83 0.69
84 0.69
85 0.67
86 0.66
87 0.66
88 0.74
89 0.72
90 0.7
91 0.7
92 0.76
93 0.8
94 0.77
95 0.72
96 0.69
97 0.73
98 0.78
99 0.78
100 0.78