Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NJD1

Protein Details
Accession A0A395NJD1   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
27-48EQKALSERKRTQQRINEIKEERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
IPR022209  CWC25  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF10197  Cir_N  
PF12542  CWC25  
Amino Acid Sequences MGGGDLNLKKSFHPGLRRNQQAVYDEEQKALSERKRTQQRINEIKEERAKEELQRQLEAAGGKKRIDRVDWMYQGPTDGQAGTTEETEAYLLGKRRIDNLIKGTDNKKLEKAAGQESFIAIQNANSARDTAAKIRDDPLLAIKRQEQAAYEAMMNDPIRRRQLLSSMEMGGGIADIGAEIVMTTDIHGAVDAHIPGLAAHDDAITETIIPRMETETGATATKRDGEITLKIGSRLRVGGERAHRRGARAEGIGKTPIAIVMAAVTVAIGTLIPMAEENDSRRDEEQARKLAAMQSAASELDQDREQRLAALEDRERVAREADDRARERGGDRGFVNGLHRKAMNMDNRSRRGHARDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.67
4 0.75
5 0.72
6 0.69
7 0.66
8 0.59
9 0.56
10 0.52
11 0.5
12 0.42
13 0.4
14 0.37
15 0.32
16 0.32
17 0.34
18 0.32
19 0.33
20 0.39
21 0.47
22 0.58
23 0.65
24 0.71
25 0.73
26 0.79
27 0.81
28 0.81
29 0.81
30 0.73
31 0.74
32 0.73
33 0.66
34 0.58
35 0.52
36 0.47
37 0.44
38 0.49
39 0.48
40 0.43
41 0.41
42 0.39
43 0.34
44 0.35
45 0.31
46 0.27
47 0.26
48 0.26
49 0.27
50 0.29
51 0.34
52 0.34
53 0.34
54 0.36
55 0.37
56 0.44
57 0.45
58 0.44
59 0.4
60 0.38
61 0.36
62 0.3
63 0.24
64 0.15
65 0.11
66 0.1
67 0.09
68 0.11
69 0.11
70 0.1
71 0.1
72 0.09
73 0.09
74 0.08
75 0.08
76 0.07
77 0.09
78 0.12
79 0.15
80 0.18
81 0.18
82 0.21
83 0.28
84 0.3
85 0.32
86 0.35
87 0.37
88 0.37
89 0.41
90 0.4
91 0.41
92 0.41
93 0.38
94 0.36
95 0.31
96 0.31
97 0.3
98 0.32
99 0.32
100 0.3
101 0.28
102 0.26
103 0.25
104 0.24
105 0.21
106 0.18
107 0.1
108 0.09
109 0.11
110 0.12
111 0.13
112 0.12
113 0.11
114 0.11
115 0.13
116 0.15
117 0.15
118 0.2
119 0.2
120 0.21
121 0.22
122 0.23
123 0.21
124 0.2
125 0.24
126 0.23
127 0.22
128 0.23
129 0.23
130 0.24
131 0.24
132 0.24
133 0.18
134 0.16
135 0.17
136 0.17
137 0.14
138 0.12
139 0.11
140 0.13
141 0.13
142 0.12
143 0.13
144 0.14
145 0.16
146 0.17
147 0.18
148 0.17
149 0.23
150 0.25
151 0.25
152 0.24
153 0.23
154 0.22
155 0.2
156 0.19
157 0.12
158 0.08
159 0.05
160 0.03
161 0.02
162 0.02
163 0.02
164 0.02
165 0.01
166 0.01
167 0.02
168 0.02
169 0.02
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.04
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.06
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.04
192 0.04
193 0.04
194 0.05
195 0.06
196 0.06
197 0.06
198 0.07
199 0.08
200 0.08
201 0.08
202 0.09
203 0.1
204 0.11
205 0.1
206 0.09
207 0.09
208 0.11
209 0.1
210 0.09
211 0.09
212 0.11
213 0.13
214 0.15
215 0.18
216 0.17
217 0.18
218 0.19
219 0.19
220 0.18
221 0.17
222 0.16
223 0.16
224 0.17
225 0.21
226 0.29
227 0.37
228 0.38
229 0.45
230 0.44
231 0.42
232 0.45
233 0.43
234 0.37
235 0.32
236 0.33
237 0.28
238 0.3
239 0.29
240 0.25
241 0.21
242 0.17
243 0.14
244 0.1
245 0.08
246 0.05
247 0.04
248 0.05
249 0.04
250 0.04
251 0.03
252 0.03
253 0.03
254 0.03
255 0.02
256 0.02
257 0.02
258 0.03
259 0.03
260 0.03
261 0.04
262 0.06
263 0.08
264 0.1
265 0.15
266 0.16
267 0.18
268 0.19
269 0.23
270 0.27
271 0.35
272 0.41
273 0.42
274 0.42
275 0.41
276 0.42
277 0.41
278 0.37
279 0.3
280 0.22
281 0.17
282 0.17
283 0.16
284 0.14
285 0.12
286 0.11
287 0.12
288 0.14
289 0.14
290 0.15
291 0.15
292 0.16
293 0.15
294 0.16
295 0.17
296 0.18
297 0.23
298 0.23
299 0.25
300 0.27
301 0.28
302 0.28
303 0.26
304 0.25
305 0.21
306 0.22
307 0.28
308 0.32
309 0.39
310 0.4
311 0.42
312 0.42
313 0.41
314 0.39
315 0.39
316 0.35
317 0.32
318 0.29
319 0.3
320 0.3
321 0.3
322 0.35
323 0.34
324 0.33
325 0.32
326 0.32
327 0.28
328 0.32
329 0.38
330 0.41
331 0.42
332 0.5
333 0.56
334 0.62
335 0.66
336 0.66
337 0.66
338 0.63