Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NDL5

Protein Details
Accession A0A395NDL5   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-57RDRGRERDTGEQKKRRAKKRRAAATKISRPHPBasic
242-271VKTFVTRSSHKHKPRPRFRSRSRQPSPLRHBasic
NLS Segment(s)
PositionSequence
30-52RERDTGEQKKRRAKKRRAAATKI
250-271SHKHKPRPRFRSRSRQPSPLRH
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences HSRQRLESTSRTSLPPHETEEAGDNRDRGRERDTGEQKKRRAKKRRAAATKISRPHPWLLSADVDSACASSLAAVLFLAPSIRELAEEQPLADRQPTRPAKPGRPISDEQTDPQRAQPKGTPKVGILSATGTIARRYSRSSSPYLRGLTAKRATAFLIHFSTPVRPFDARTRFFSPSTLRSASPTSSSHYLTLPQASPPQLLLSANTTPRANAATRRCLHFPSPAHRRNSTLTEPPSTRGPVKTFVTRSSHKHKPRPRFRSRSRQPSPLRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.41
4 0.37
5 0.35
6 0.35
7 0.39
8 0.36
9 0.33
10 0.32
11 0.27
12 0.26
13 0.31
14 0.32
15 0.27
16 0.29
17 0.31
18 0.33
19 0.43
20 0.52
21 0.57
22 0.65
23 0.71
24 0.74
25 0.79
26 0.85
27 0.85
28 0.86
29 0.86
30 0.85
31 0.88
32 0.9
33 0.9
34 0.89
35 0.89
36 0.89
37 0.87
38 0.84
39 0.77
40 0.7
41 0.64
42 0.61
43 0.52
44 0.44
45 0.37
46 0.32
47 0.31
48 0.28
49 0.26
50 0.21
51 0.19
52 0.16
53 0.14
54 0.11
55 0.08
56 0.07
57 0.04
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.03
67 0.04
68 0.05
69 0.05
70 0.06
71 0.07
72 0.09
73 0.13
74 0.13
75 0.13
76 0.14
77 0.14
78 0.14
79 0.15
80 0.15
81 0.13
82 0.23
83 0.28
84 0.29
85 0.37
86 0.43
87 0.47
88 0.55
89 0.62
90 0.57
91 0.59
92 0.58
93 0.54
94 0.53
95 0.47
96 0.4
97 0.39
98 0.36
99 0.3
100 0.31
101 0.34
102 0.29
103 0.3
104 0.33
105 0.34
106 0.38
107 0.4
108 0.37
109 0.3
110 0.33
111 0.31
112 0.27
113 0.18
114 0.13
115 0.11
116 0.09
117 0.1
118 0.08
119 0.07
120 0.08
121 0.08
122 0.08
123 0.11
124 0.14
125 0.18
126 0.21
127 0.26
128 0.29
129 0.32
130 0.35
131 0.34
132 0.32
133 0.31
134 0.28
135 0.31
136 0.29
137 0.27
138 0.23
139 0.22
140 0.21
141 0.21
142 0.2
143 0.16
144 0.15
145 0.14
146 0.14
147 0.14
148 0.18
149 0.17
150 0.17
151 0.17
152 0.15
153 0.18
154 0.27
155 0.35
156 0.34
157 0.38
158 0.42
159 0.42
160 0.42
161 0.43
162 0.39
163 0.33
164 0.36
165 0.32
166 0.27
167 0.27
168 0.29
169 0.26
170 0.25
171 0.23
172 0.21
173 0.22
174 0.23
175 0.22
176 0.21
177 0.22
178 0.2
179 0.22
180 0.18
181 0.17
182 0.19
183 0.19
184 0.19
185 0.17
186 0.17
187 0.15
188 0.14
189 0.13
190 0.14
191 0.16
192 0.17
193 0.19
194 0.18
195 0.17
196 0.18
197 0.2
198 0.18
199 0.22
200 0.27
201 0.35
202 0.38
203 0.43
204 0.44
205 0.45
206 0.45
207 0.46
208 0.45
209 0.45
210 0.53
211 0.56
212 0.59
213 0.58
214 0.59
215 0.56
216 0.57
217 0.53
218 0.51
219 0.48
220 0.49
221 0.49
222 0.48
223 0.47
224 0.44
225 0.41
226 0.38
227 0.37
228 0.37
229 0.4
230 0.46
231 0.44
232 0.47
233 0.5
234 0.51
235 0.55
236 0.57
237 0.63
238 0.64
239 0.71
240 0.75
241 0.79
242 0.85
243 0.88
244 0.91
245 0.92
246 0.92
247 0.93
248 0.94
249 0.94
250 0.91
251 0.9