Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NM01

Protein Details
Accession A0A395NM01    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
84-103DYPHPHPHPHPHPHHYPQQQBasic
567-591QKSASPIMPRKRRTRRSQPPIWALSHydrophilic
NLS Segment(s)
PositionSequence
576-581RKRRTR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR040343  Cet1/Ctl1  
IPR033469  CYTH-like_dom_sf  
IPR004206  mRNA_triPase_Cet1  
IPR037009  mRNA_triPase_Cet1_sf  
Gene Ontology GO:0031533  C:mRNA cap methyltransferase complex  
GO:0004651  F:polynucleotide 5'-phosphatase activity  
GO:0006370  P:7-methylguanosine mRNA capping  
Pfam View protein in Pfam  
PF02940  mRNA_triPase  
CDD cd07470  CYTH-like_mRNA_RTPase  
Amino Acid Sequences MDLRSVLNTSDNGDRAPPRPAPTPQQQQQHQLQQQQQQQQLHQQQQHPHQQQQPRPVQSPAQYGFRDYPQQPPQASPSKPPSHDYPHPHPHPHPHPHHYPQQQQQQPNAYPPPPSPYQGPGPYQSRPAPPPPLQPPSLYHDPRSPGSSRSNSGPVIASPYRPSPTSATTPGGNAGYPFPTQPPEMASPIQRQQFPPGQYQDPRRDSYVQSPGVAPPAQYVQQHAVPLASPVRTTSSGASHAYLHQPPAHSTPTPASTQAQHPQYGPPYAQGSPVLAAQPPLADYNRHPSQPPTPLGPPQQQPSVQRQPSTPGAFAQPPPSPYQQRMSSSLAAGGPAPAHAHAPAPAPAPAHAPPPAHAPAHSHTQAHTQAQAQAQAQAQAQAQAQAQAQAQQQQRQQQHAQVHAQQQQQQQPQAHAAQVQAPIQPPPQTQVQTPVQAQTQPSPKPAPPPPPAPPAHRLSSSQSAYGSPVAEPAQRPRSQHERDQSLSVSPKTRLGSIPSNPDVTPAPADRAARSSLSVHSMAIDSDRAVTPAKRKLEDLNMSPGELEYKESKPPPGEVNGGYAERIQKSASPIMPRKRRTRRSQPPIWALSIHTLGRKLPSTPNFVLQKRIHSHIQAAVNGRHEPAIKAEQPSRQASPESRRNQQASVSQQPAAAAEPDPQDTLGPWEASITGVKPMEELSKNVADFLFNHVINNQDIQEITSRGIQFEIEAKLGTLIDKDTNQRVDRFVTTECVLADNGRVAFRSSMTEAYHKSYNDFLNNIVVQTDPRNPNGSTNRVPVIYKHSREIDRFFDLPSEMHGHLPGCVRARIGSRRNVRVRVTYEPKTNEVVNKIIKARVADIDLHLPMCPMDCRISINLEMNWDGSVEELEQLSANKTDRQPDRNKDRLSYKQGSYQIDLTQVTHAVHGPGNSQRMDKEHELEIEMNPQVLLDQGRRAMSGAPHRYQELVEGFVDNVRVLARKAKEFNRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.34
4 0.35
5 0.35
6 0.41
7 0.46
8 0.5
9 0.56
10 0.64
11 0.65
12 0.7
13 0.71
14 0.73
15 0.76
16 0.78
17 0.74
18 0.72
19 0.71
20 0.7
21 0.73
22 0.72
23 0.71
24 0.65
25 0.62
26 0.64
27 0.66
28 0.66
29 0.65
30 0.63
31 0.65
32 0.69
33 0.77
34 0.73
35 0.72
36 0.71
37 0.74
38 0.74
39 0.76
40 0.77
41 0.73
42 0.7
43 0.66
44 0.64
45 0.6
46 0.62
47 0.55
48 0.53
49 0.47
50 0.47
51 0.47
52 0.44
53 0.47
54 0.39
55 0.45
56 0.45
57 0.51
58 0.48
59 0.48
60 0.51
61 0.52
62 0.53
63 0.51
64 0.54
65 0.56
66 0.57
67 0.58
68 0.58
69 0.58
70 0.64
71 0.65
72 0.65
73 0.67
74 0.71
75 0.74
76 0.71
77 0.73
78 0.74
79 0.76
80 0.75
81 0.72
82 0.75
83 0.75
84 0.8
85 0.79
86 0.78
87 0.77
88 0.78
89 0.78
90 0.75
91 0.75
92 0.74
93 0.67
94 0.65
95 0.62
96 0.53
97 0.49
98 0.45
99 0.44
100 0.38
101 0.38
102 0.34
103 0.33
104 0.39
105 0.41
106 0.43
107 0.44
108 0.45
109 0.45
110 0.48
111 0.48
112 0.46
113 0.46
114 0.48
115 0.5
116 0.5
117 0.56
118 0.58
119 0.59
120 0.55
121 0.52
122 0.5
123 0.49
124 0.55
125 0.49
126 0.44
127 0.44
128 0.46
129 0.46
130 0.47
131 0.41
132 0.35
133 0.41
134 0.43
135 0.4
136 0.41
137 0.43
138 0.38
139 0.38
140 0.35
141 0.26
142 0.29
143 0.27
144 0.24
145 0.23
146 0.27
147 0.28
148 0.27
149 0.29
150 0.26
151 0.3
152 0.33
153 0.34
154 0.33
155 0.31
156 0.31
157 0.31
158 0.27
159 0.22
160 0.17
161 0.15
162 0.14
163 0.14
164 0.14
165 0.14
166 0.15
167 0.16
168 0.16
169 0.19
170 0.2
171 0.23
172 0.24
173 0.27
174 0.3
175 0.35
176 0.4
177 0.38
178 0.36
179 0.4
180 0.44
181 0.44
182 0.45
183 0.44
184 0.46
185 0.5
186 0.57
187 0.59
188 0.58
189 0.57
190 0.54
191 0.52
192 0.49
193 0.51
194 0.51
195 0.43
196 0.39
197 0.37
198 0.34
199 0.34
200 0.32
201 0.23
202 0.16
203 0.17
204 0.19
205 0.18
206 0.2
207 0.19
208 0.21
209 0.22
210 0.2
211 0.18
212 0.15
213 0.17
214 0.16
215 0.13
216 0.11
217 0.11
218 0.15
219 0.16
220 0.18
221 0.17
222 0.17
223 0.2
224 0.21
225 0.21
226 0.18
227 0.19
228 0.23
229 0.23
230 0.22
231 0.21
232 0.22
233 0.23
234 0.26
235 0.27
236 0.22
237 0.23
238 0.24
239 0.25
240 0.25
241 0.24
242 0.22
243 0.22
244 0.27
245 0.32
246 0.32
247 0.3
248 0.29
249 0.32
250 0.33
251 0.32
252 0.27
253 0.22
254 0.23
255 0.22
256 0.22
257 0.19
258 0.17
259 0.15
260 0.16
261 0.14
262 0.1
263 0.1
264 0.09
265 0.09
266 0.09
267 0.1
268 0.1
269 0.11
270 0.13
271 0.21
272 0.24
273 0.25
274 0.25
275 0.26
276 0.32
277 0.38
278 0.39
279 0.35
280 0.35
281 0.39
282 0.44
283 0.47
284 0.44
285 0.4
286 0.42
287 0.4
288 0.41
289 0.45
290 0.5
291 0.46
292 0.44
293 0.41
294 0.42
295 0.45
296 0.44
297 0.36
298 0.27
299 0.27
300 0.28
301 0.29
302 0.28
303 0.23
304 0.22
305 0.26
306 0.3
307 0.3
308 0.3
309 0.35
310 0.36
311 0.37
312 0.4
313 0.4
314 0.36
315 0.33
316 0.32
317 0.25
318 0.2
319 0.17
320 0.12
321 0.08
322 0.07
323 0.07
324 0.06
325 0.06
326 0.06
327 0.07
328 0.08
329 0.09
330 0.11
331 0.12
332 0.12
333 0.12
334 0.13
335 0.15
336 0.15
337 0.16
338 0.17
339 0.16
340 0.16
341 0.21
342 0.23
343 0.2
344 0.19
345 0.21
346 0.2
347 0.27
348 0.27
349 0.23
350 0.21
351 0.26
352 0.29
353 0.26
354 0.26
355 0.2
356 0.22
357 0.22
358 0.25
359 0.19
360 0.19
361 0.18
362 0.19
363 0.18
364 0.16
365 0.15
366 0.14
367 0.14
368 0.13
369 0.13
370 0.13
371 0.13
372 0.13
373 0.13
374 0.15
375 0.16
376 0.21
377 0.23
378 0.26
379 0.28
380 0.34
381 0.37
382 0.38
383 0.39
384 0.38
385 0.4
386 0.39
387 0.4
388 0.37
389 0.41
390 0.42
391 0.43
392 0.43
393 0.44
394 0.46
395 0.46
396 0.45
397 0.4
398 0.35
399 0.35
400 0.3
401 0.26
402 0.2
403 0.17
404 0.16
405 0.16
406 0.16
407 0.15
408 0.14
409 0.14
410 0.15
411 0.16
412 0.13
413 0.14
414 0.17
415 0.17
416 0.17
417 0.22
418 0.24
419 0.25
420 0.25
421 0.25
422 0.21
423 0.22
424 0.22
425 0.21
426 0.24
427 0.22
428 0.24
429 0.26
430 0.26
431 0.3
432 0.35
433 0.38
434 0.36
435 0.41
436 0.43
437 0.47
438 0.49
439 0.47
440 0.47
441 0.43
442 0.41
443 0.36
444 0.34
445 0.31
446 0.36
447 0.32
448 0.27
449 0.24
450 0.22
451 0.21
452 0.2
453 0.16
454 0.09
455 0.09
456 0.09
457 0.1
458 0.11
459 0.15
460 0.21
461 0.23
462 0.24
463 0.28
464 0.36
465 0.39
466 0.44
467 0.46
468 0.44
469 0.44
470 0.45
471 0.4
472 0.33
473 0.32
474 0.28
475 0.24
476 0.19
477 0.21
478 0.2
479 0.2
480 0.18
481 0.2
482 0.24
483 0.24
484 0.3
485 0.27
486 0.29
487 0.27
488 0.27
489 0.23
490 0.18
491 0.18
492 0.12
493 0.13
494 0.13
495 0.14
496 0.13
497 0.15
498 0.15
499 0.13
500 0.14
501 0.13
502 0.12
503 0.14
504 0.14
505 0.12
506 0.11
507 0.11
508 0.1
509 0.09
510 0.08
511 0.05
512 0.06
513 0.06
514 0.07
515 0.08
516 0.09
517 0.14
518 0.2
519 0.23
520 0.23
521 0.24
522 0.26
523 0.33
524 0.36
525 0.33
526 0.34
527 0.31
528 0.3
529 0.29
530 0.26
531 0.19
532 0.15
533 0.15
534 0.11
535 0.12
536 0.16
537 0.17
538 0.19
539 0.19
540 0.21
541 0.21
542 0.21
543 0.22
544 0.19
545 0.2
546 0.2
547 0.19
548 0.17
549 0.16
550 0.16
551 0.13
552 0.13
553 0.11
554 0.11
555 0.14
556 0.18
557 0.2
558 0.25
559 0.31
560 0.4
561 0.48
562 0.53
563 0.61
564 0.67
565 0.74
566 0.77
567 0.81
568 0.83
569 0.84
570 0.87
571 0.85
572 0.82
573 0.75
574 0.66
575 0.56
576 0.45
577 0.38
578 0.32
579 0.24
580 0.17
581 0.15
582 0.15
583 0.16
584 0.16
585 0.16
586 0.2
587 0.23
588 0.29
589 0.3
590 0.36
591 0.4
592 0.4
593 0.47
594 0.41
595 0.45
596 0.41
597 0.44
598 0.39
599 0.34
600 0.36
601 0.33
602 0.34
603 0.3
604 0.3
605 0.28
606 0.28
607 0.27
608 0.25
609 0.21
610 0.18
611 0.16
612 0.16
613 0.19
614 0.19
615 0.22
616 0.26
617 0.28
618 0.32
619 0.35
620 0.32
621 0.28
622 0.29
623 0.31
624 0.36
625 0.42
626 0.43
627 0.45
628 0.5
629 0.51
630 0.49
631 0.48
632 0.46
633 0.43
634 0.46
635 0.42
636 0.36
637 0.34
638 0.33
639 0.3
640 0.24
641 0.18
642 0.11
643 0.11
644 0.12
645 0.12
646 0.12
647 0.12
648 0.11
649 0.1
650 0.13
651 0.12
652 0.11
653 0.1
654 0.1
655 0.1
656 0.11
657 0.11
658 0.08
659 0.1
660 0.1
661 0.1
662 0.1
663 0.11
664 0.16
665 0.16
666 0.17
667 0.18
668 0.21
669 0.21
670 0.21
671 0.2
672 0.15
673 0.15
674 0.21
675 0.22
676 0.18
677 0.19
678 0.19
679 0.21
680 0.21
681 0.21
682 0.15
683 0.1
684 0.1
685 0.11
686 0.13
687 0.11
688 0.12
689 0.15
690 0.15
691 0.14
692 0.15
693 0.13
694 0.12
695 0.15
696 0.15
697 0.11
698 0.11
699 0.11
700 0.11
701 0.11
702 0.11
703 0.08
704 0.08
705 0.09
706 0.11
707 0.15
708 0.19
709 0.25
710 0.27
711 0.28
712 0.28
713 0.3
714 0.29
715 0.28
716 0.25
717 0.23
718 0.21
719 0.21
720 0.19
721 0.17
722 0.15
723 0.13
724 0.13
725 0.12
726 0.12
727 0.11
728 0.11
729 0.12
730 0.12
731 0.13
732 0.15
733 0.14
734 0.17
735 0.18
736 0.22
737 0.23
738 0.26
739 0.29
740 0.26
741 0.26
742 0.28
743 0.29
744 0.28
745 0.27
746 0.24
747 0.24
748 0.24
749 0.23
750 0.18
751 0.15
752 0.13
753 0.16
754 0.23
755 0.21
756 0.23
757 0.27
758 0.27
759 0.36
760 0.41
761 0.45
762 0.41
763 0.42
764 0.42
765 0.4
766 0.4
767 0.34
768 0.37
769 0.39
770 0.37
771 0.38
772 0.43
773 0.46
774 0.49
775 0.52
776 0.47
777 0.44
778 0.42
779 0.37
780 0.32
781 0.28
782 0.24
783 0.23
784 0.23
785 0.18
786 0.18
787 0.19
788 0.17
789 0.19
790 0.21
791 0.22
792 0.2
793 0.2
794 0.2
795 0.21
796 0.28
797 0.35
798 0.39
799 0.44
800 0.5
801 0.59
802 0.66
803 0.69
804 0.67
805 0.65
806 0.64
807 0.64
808 0.64
809 0.6
810 0.61
811 0.58
812 0.57
813 0.52
814 0.5
815 0.45
816 0.4
817 0.41
818 0.36
819 0.37
820 0.37
821 0.36
822 0.35
823 0.32
824 0.31
825 0.28
826 0.26
827 0.23
828 0.23
829 0.25
830 0.24
831 0.23
832 0.2
833 0.17
834 0.14
835 0.14
836 0.13
837 0.11
838 0.13
839 0.14
840 0.17
841 0.19
842 0.23
843 0.24
844 0.27
845 0.26
846 0.26
847 0.25
848 0.23
849 0.21
850 0.17
851 0.14
852 0.1
853 0.1
854 0.07
855 0.08
856 0.07
857 0.08
858 0.08
859 0.09
860 0.11
861 0.13
862 0.15
863 0.2
864 0.22
865 0.31
866 0.38
867 0.46
868 0.54
869 0.61
870 0.7
871 0.73
872 0.75
873 0.73
874 0.75
875 0.75
876 0.75
877 0.72
878 0.65
879 0.64
880 0.66
881 0.64
882 0.58
883 0.51
884 0.44
885 0.4
886 0.38
887 0.31
888 0.26
889 0.23
890 0.2
891 0.18
892 0.18
893 0.16
894 0.16
895 0.16
896 0.18
897 0.21
898 0.25
899 0.26
900 0.26
901 0.27
902 0.29
903 0.36
904 0.36
905 0.34
906 0.34
907 0.34
908 0.35
909 0.35
910 0.32
911 0.3
912 0.26
913 0.23
914 0.18
915 0.16
916 0.13
917 0.13
918 0.15
919 0.12
920 0.16
921 0.19
922 0.2
923 0.21
924 0.22
925 0.23
926 0.27
927 0.35
928 0.39
929 0.4
930 0.42
931 0.43
932 0.43
933 0.4
934 0.39
935 0.31
936 0.26
937 0.23
938 0.21
939 0.2
940 0.2
941 0.21
942 0.14
943 0.12
944 0.11
945 0.12
946 0.12
947 0.2
948 0.23
949 0.31
950 0.39