Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NJN0

Protein Details
Accession A0A395NJN0   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-81VAVDHRHPSHKDREPRRDPRAPRDPRDPRGPRDPRDLTRDQRERERQRRERKPRVEDDHRRVRPEPKDRDPRDPRDLRBasic
260-279SQKVARRPSRAKKAPPPPEEHydrophilic
NLS Segment(s)
PositionSequence
11-105PSHKDREPRRDPRAPRDPRDPRGPRDPRDLTRDQRERERQRRERKPRVEDDHRRVRPEPKDRDPRDPRDLRDLREPRDPRDPRGLKKARPAPPKH
263-297VARRPSRAKKAPPPPEERKKMPPPDYAPKRTQSAR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MRPVAVDHRHPSHKDREPRRDPRAPRDPRDPRGPRDPRDLTRDQRERERQRRERKPRVEDDHRRVRPEPKDRDPRDPRDLRDLREPRDPRDPRGLKKARPAPPKHAASQPVVSQGAYRRGQFEDPAAYGVQQPAASGQRPRAKTRPASYYGGQPPLHPLDMGWVGPHPPPPPGAFGVGNFPPPHMFAPGAPQMHPGMPPPSPMGMGPPLFFDGPMGPPPPGEHLRHRFDGRPSSAMGFGSPPDAIGYFPDEYEDYEEEPSQKVARRPSRAKKAPPPPEERKKMPPPDYAPKRTQSARPTTGAYKPPLAREPMREPPREHLREQPREHTREQVRERPQSRPAQQRAPPSHRRSVGFVDQQAYEEDDFAGEVDLYQEVPPNQRRTALTRPRRSSSVAYDQNGYDIVPAGNRGRRSSMYGPGPHESFGGASLEEDNRYFDALRYQEDVSGGTPMPLTAESLRKASKRGELASSRSTRSSGSHDESDYKRSHTTGLTTQSSAAHNNDDFTIKVSGQAVVKVPGGPQIECEGGEITFSSSRGAGAGPASGPPGASRAGSDKESTIYQLDDARSSRMDRKALPHRPRATSQSDVHSRIYAPLHHAPYEHAPYEHAPYEHVPYEEHYEQITYEHAPYDPSLAASNFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.77
4 0.8
5 0.86
6 0.9
7 0.89
8 0.88
9 0.88
10 0.88
11 0.87
12 0.84
13 0.84
14 0.85
15 0.83
16 0.85
17 0.82
18 0.79
19 0.8
20 0.82
21 0.76
22 0.77
23 0.77
24 0.73
25 0.73
26 0.74
27 0.72
28 0.73
29 0.76
30 0.71
31 0.74
32 0.78
33 0.81
34 0.83
35 0.86
36 0.85
37 0.87
38 0.93
39 0.93
40 0.94
41 0.93
42 0.93
43 0.92
44 0.92
45 0.92
46 0.92
47 0.9
48 0.9
49 0.85
50 0.81
51 0.74
52 0.73
53 0.72
54 0.72
55 0.72
56 0.71
57 0.77
58 0.77
59 0.84
60 0.84
61 0.83
62 0.83
63 0.8
64 0.73
65 0.73
66 0.73
67 0.67
68 0.68
69 0.66
70 0.6
71 0.63
72 0.62
73 0.56
74 0.62
75 0.61
76 0.56
77 0.6
78 0.63
79 0.59
80 0.67
81 0.71
82 0.66
83 0.72
84 0.76
85 0.74
86 0.78
87 0.78
88 0.76
89 0.77
90 0.76
91 0.7
92 0.67
93 0.63
94 0.57
95 0.54
96 0.47
97 0.42
98 0.37
99 0.33
100 0.29
101 0.29
102 0.33
103 0.31
104 0.3
105 0.28
106 0.3
107 0.32
108 0.3
109 0.29
110 0.24
111 0.22
112 0.23
113 0.2
114 0.18
115 0.18
116 0.17
117 0.15
118 0.11
119 0.11
120 0.12
121 0.15
122 0.17
123 0.18
124 0.25
125 0.31
126 0.35
127 0.42
128 0.46
129 0.51
130 0.57
131 0.61
132 0.62
133 0.59
134 0.61
135 0.56
136 0.58
137 0.55
138 0.54
139 0.48
140 0.4
141 0.4
142 0.38
143 0.36
144 0.27
145 0.21
146 0.18
147 0.2
148 0.19
149 0.14
150 0.12
151 0.13
152 0.14
153 0.18
154 0.14
155 0.14
156 0.16
157 0.16
158 0.19
159 0.19
160 0.21
161 0.18
162 0.18
163 0.22
164 0.2
165 0.22
166 0.19
167 0.18
168 0.16
169 0.17
170 0.17
171 0.14
172 0.14
173 0.11
174 0.17
175 0.22
176 0.22
177 0.21
178 0.22
179 0.21
180 0.22
181 0.22
182 0.18
183 0.16
184 0.15
185 0.16
186 0.16
187 0.15
188 0.15
189 0.14
190 0.15
191 0.16
192 0.16
193 0.15
194 0.14
195 0.15
196 0.14
197 0.14
198 0.12
199 0.1
200 0.1
201 0.12
202 0.12
203 0.11
204 0.11
205 0.12
206 0.17
207 0.2
208 0.22
209 0.28
210 0.35
211 0.4
212 0.44
213 0.46
214 0.45
215 0.45
216 0.5
217 0.44
218 0.38
219 0.34
220 0.32
221 0.3
222 0.26
223 0.21
224 0.14
225 0.11
226 0.1
227 0.09
228 0.07
229 0.07
230 0.07
231 0.06
232 0.06
233 0.09
234 0.08
235 0.08
236 0.09
237 0.09
238 0.09
239 0.12
240 0.12
241 0.1
242 0.11
243 0.12
244 0.12
245 0.12
246 0.13
247 0.12
248 0.15
249 0.17
250 0.26
251 0.33
252 0.41
253 0.49
254 0.58
255 0.67
256 0.71
257 0.76
258 0.77
259 0.79
260 0.81
261 0.79
262 0.79
263 0.78
264 0.8
265 0.78
266 0.73
267 0.72
268 0.71
269 0.72
270 0.68
271 0.65
272 0.61
273 0.66
274 0.69
275 0.66
276 0.61
277 0.56
278 0.54
279 0.5
280 0.5
281 0.46
282 0.46
283 0.43
284 0.41
285 0.41
286 0.4
287 0.42
288 0.4
289 0.35
290 0.32
291 0.3
292 0.31
293 0.31
294 0.31
295 0.28
296 0.29
297 0.33
298 0.37
299 0.42
300 0.43
301 0.42
302 0.45
303 0.54
304 0.52
305 0.48
306 0.47
307 0.51
308 0.57
309 0.58
310 0.59
311 0.56
312 0.57
313 0.57
314 0.56
315 0.51
316 0.51
317 0.53
318 0.53
319 0.53
320 0.57
321 0.59
322 0.55
323 0.57
324 0.56
325 0.58
326 0.6
327 0.57
328 0.57
329 0.59
330 0.64
331 0.65
332 0.65
333 0.67
334 0.63
335 0.65
336 0.6
337 0.57
338 0.51
339 0.48
340 0.47
341 0.41
342 0.37
343 0.32
344 0.28
345 0.27
346 0.24
347 0.21
348 0.14
349 0.1
350 0.09
351 0.06
352 0.06
353 0.05
354 0.05
355 0.03
356 0.03
357 0.03
358 0.04
359 0.04
360 0.04
361 0.06
362 0.07
363 0.13
364 0.18
365 0.22
366 0.22
367 0.25
368 0.27
369 0.32
370 0.42
371 0.47
372 0.52
373 0.58
374 0.63
375 0.62
376 0.63
377 0.6
378 0.53
379 0.5
380 0.5
381 0.46
382 0.42
383 0.4
384 0.38
385 0.34
386 0.3
387 0.23
388 0.13
389 0.09
390 0.07
391 0.06
392 0.08
393 0.1
394 0.13
395 0.15
396 0.16
397 0.18
398 0.19
399 0.26
400 0.27
401 0.31
402 0.34
403 0.37
404 0.39
405 0.39
406 0.39
407 0.32
408 0.29
409 0.22
410 0.16
411 0.13
412 0.1
413 0.07
414 0.07
415 0.08
416 0.09
417 0.09
418 0.09
419 0.1
420 0.09
421 0.1
422 0.1
423 0.09
424 0.14
425 0.14
426 0.16
427 0.18
428 0.18
429 0.18
430 0.18
431 0.19
432 0.13
433 0.14
434 0.12
435 0.1
436 0.09
437 0.08
438 0.08
439 0.08
440 0.09
441 0.09
442 0.13
443 0.14
444 0.18
445 0.22
446 0.22
447 0.25
448 0.26
449 0.3
450 0.31
451 0.33
452 0.37
453 0.38
454 0.42
455 0.48
456 0.48
457 0.43
458 0.39
459 0.37
460 0.31
461 0.29
462 0.3
463 0.29
464 0.3
465 0.31
466 0.32
467 0.37
468 0.38
469 0.41
470 0.37
471 0.33
472 0.29
473 0.27
474 0.28
475 0.23
476 0.25
477 0.26
478 0.31
479 0.31
480 0.3
481 0.3
482 0.31
483 0.3
484 0.29
485 0.24
486 0.21
487 0.19
488 0.19
489 0.19
490 0.18
491 0.16
492 0.16
493 0.17
494 0.13
495 0.15
496 0.15
497 0.16
498 0.16
499 0.18
500 0.17
501 0.16
502 0.17
503 0.16
504 0.15
505 0.19
506 0.2
507 0.18
508 0.18
509 0.18
510 0.18
511 0.18
512 0.19
513 0.14
514 0.12
515 0.12
516 0.1
517 0.1
518 0.11
519 0.11
520 0.11
521 0.1
522 0.1
523 0.1
524 0.1
525 0.09
526 0.08
527 0.09
528 0.08
529 0.09
530 0.1
531 0.09
532 0.09
533 0.09
534 0.1
535 0.1
536 0.09
537 0.1
538 0.14
539 0.17
540 0.19
541 0.2
542 0.2
543 0.21
544 0.22
545 0.22
546 0.19
547 0.16
548 0.16
549 0.19
550 0.19
551 0.21
552 0.21
553 0.22
554 0.23
555 0.26
556 0.32
557 0.34
558 0.37
559 0.37
560 0.46
561 0.54
562 0.62
563 0.67
564 0.7
565 0.72
566 0.73
567 0.75
568 0.73
569 0.69
570 0.65
571 0.61
572 0.6
573 0.6
574 0.57
575 0.54
576 0.49
577 0.43
578 0.4
579 0.38
580 0.32
581 0.31
582 0.35
583 0.37
584 0.36
585 0.36
586 0.35
587 0.4
588 0.43
589 0.38
590 0.31
591 0.3
592 0.31
593 0.37
594 0.37
595 0.29
596 0.26
597 0.26
598 0.31
599 0.32
600 0.3
601 0.25
602 0.24
603 0.33
604 0.31
605 0.29
606 0.24
607 0.22
608 0.21
609 0.21
610 0.21
611 0.14
612 0.15
613 0.15
614 0.15
615 0.16
616 0.16
617 0.19
618 0.17
619 0.16
620 0.18