Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NES2

Protein Details
Accession A0A395NES2    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-39GALKLKGAKVSKKKKKAAKSDLEKNLSAHydrophilic
52-73DNTPKDRRDKNKSPKDEDRKGEBasic
NLS Segment(s)
PositionSequence
15-30KLKGAKVSKKKKKAAK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGSDDYKITGGGALKLKGAKVSKKKKKAAKSDLEKNLSAGGDESALVKKDGDNTPKDRRDKNKSPKDEDRKGEDGEDREDDDEPVVLKTESERRHEETRKKRLLQIAQSSGSRPELLKTHKERVEELNTYLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.25
5 0.29
6 0.34
7 0.41
8 0.52
9 0.6
10 0.69
11 0.78
12 0.81
13 0.86
14 0.87
15 0.87
16 0.87
17 0.86
18 0.86
19 0.87
20 0.82
21 0.72
22 0.61
23 0.53
24 0.42
25 0.32
26 0.22
27 0.13
28 0.09
29 0.09
30 0.09
31 0.08
32 0.09
33 0.09
34 0.08
35 0.08
36 0.14
37 0.19
38 0.22
39 0.26
40 0.32
41 0.41
42 0.48
43 0.53
44 0.54
45 0.58
46 0.63
47 0.69
48 0.74
49 0.75
50 0.75
51 0.78
52 0.81
53 0.82
54 0.8
55 0.73
56 0.69
57 0.62
58 0.55
59 0.49
60 0.41
61 0.33
62 0.27
63 0.24
64 0.18
65 0.15
66 0.15
67 0.13
68 0.11
69 0.09
70 0.08
71 0.07
72 0.07
73 0.06
74 0.05
75 0.07
76 0.15
77 0.18
78 0.22
79 0.26
80 0.3
81 0.39
82 0.47
83 0.56
84 0.59
85 0.66
86 0.7
87 0.69
88 0.69
89 0.69
90 0.69
91 0.67
92 0.65
93 0.6
94 0.54
95 0.52
96 0.49
97 0.42
98 0.36
99 0.28
100 0.2
101 0.17
102 0.2
103 0.25
104 0.33
105 0.38
106 0.45
107 0.48
108 0.49
109 0.5
110 0.51
111 0.53
112 0.47
113 0.42
114 0.42
115 0.39
116 0.38
117 0.35
118 0.28
119 0.21
120 0.2
121 0.23
122 0.2
123 0.23
124 0.29
125 0.34
126 0.36