Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395NMK2

Protein Details
Accession A0A395NMK2    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKNKKAHNIKFKVRCQKHHydrophilic
NLS Segment(s)
PositionSequence
22-33SARIKKNKKAHN
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKEVADIKKFIEICRRKDASSARIKKNKKAHNIKFKVRCQKHLYTLVLKDSDKAEKLKQSLPPSMRSDPPKAQFTGVFQDEDDRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.51
4 0.45
5 0.51
6 0.55
7 0.54
8 0.57
9 0.61
10 0.61
11 0.67
12 0.7
13 0.72
14 0.76
15 0.75
16 0.74
17 0.76
18 0.76
19 0.79
20 0.83
21 0.84
22 0.83
23 0.83
24 0.83
25 0.75
26 0.73
27 0.68
28 0.65
29 0.62
30 0.59
31 0.54
32 0.47
33 0.45
34 0.4
35 0.36
36 0.31
37 0.26
38 0.21
39 0.21
40 0.19
41 0.2
42 0.2
43 0.23
44 0.26
45 0.29
46 0.34
47 0.36
48 0.42
49 0.42
50 0.46
51 0.47
52 0.48
53 0.5
54 0.49
55 0.51
56 0.51
57 0.55
58 0.53
59 0.48
60 0.47
61 0.42
62 0.4
63 0.42
64 0.36
65 0.3
66 0.26