Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NMA2

Protein Details
Accession A0A395NMA2    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSRFQKRRHRLRLRAVDSVHydrophilic
77-96KYTMFDRKEKKYRKGIHSTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRATNPLSGGLLWKIPWRLSRFQKRRHRLRLRAVDSVVATLDAALAKKGQTLEAIERWKAEMPVEEEMLPKDKYTMFDRKEKKYRKGIHSTAWSPHDFPVDWMEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.29
9 0.36
10 0.45
11 0.56
12 0.61
13 0.7
14 0.78
15 0.82
16 0.87
17 0.9
18 0.9
19 0.88
20 0.9
21 0.9
22 0.85
23 0.8
24 0.69
25 0.6
26 0.5
27 0.41
28 0.3
29 0.19
30 0.13
31 0.07
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.06
40 0.06
41 0.06
42 0.08
43 0.1
44 0.15
45 0.17
46 0.16
47 0.16
48 0.17
49 0.17
50 0.16
51 0.14
52 0.12
53 0.13
54 0.15
55 0.16
56 0.15
57 0.15
58 0.15
59 0.18
60 0.15
61 0.13
62 0.12
63 0.13
64 0.15
65 0.21
66 0.29
67 0.29
68 0.39
69 0.46
70 0.54
71 0.63
72 0.69
73 0.72
74 0.73
75 0.79
76 0.79
77 0.82
78 0.78
79 0.77
80 0.77
81 0.72
82 0.69
83 0.64
84 0.57
85 0.48
86 0.45
87 0.41
88 0.32
89 0.3