Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395NH93

Protein Details
Accession A0A395NH93    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-86HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLLRTLSLTTGLLRSASAVKPFAAGSFATAPSPISAWMGWLAKPAIAGSLQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.13
5 0.14
6 0.15
7 0.16
8 0.15
9 0.16
10 0.16
11 0.15
12 0.13
13 0.11
14 0.11
15 0.12
16 0.12
17 0.11
18 0.11
19 0.11
20 0.1
21 0.11
22 0.08
23 0.07
24 0.06
25 0.07
26 0.09
27 0.1
28 0.09
29 0.11
30 0.1
31 0.09
32 0.1
33 0.09
34 0.07
35 0.06
36 0.06
37 0.07
38 0.12
39 0.12
40 0.15
41 0.15
42 0.15
43 0.16
44 0.17
45 0.15
46 0.14
47 0.23
48 0.27
49 0.35
50 0.4
51 0.46
52 0.53
53 0.57
54 0.63
55 0.63
56 0.65
57 0.67
58 0.72
59 0.75
60 0.78
61 0.82
62 0.81
63 0.81
64 0.82
65 0.83
66 0.84
67 0.81
68 0.79
69 0.77
70 0.72
71 0.68
72 0.64
73 0.57
74 0.5
75 0.43
76 0.35
77 0.35
78 0.39
79 0.45
80 0.48
81 0.54