Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NP11

Protein Details
Accession A0A395NP11   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
584-614LPDVNKRPKLTEKKRGRPPSTDPKQKKLSFRBasic
NLS Segment(s)
PositionSequence
589-613KRPKLTEKKRGRPPSTDPKQKKLSF
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR036775  DNA_pol_Y-fam_lit_finger_sf  
IPR022880  DNApol_IV  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR001126  UmuC  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003684  F:damaged DNA binding  
GO:0003887  F:DNA-directed DNA polymerase activity  
GO:0070987  P:error-free translesion synthesis  
Pfam View protein in Pfam  
PF00817  IMS  
PROSITE View protein in PROSITE  
PS50173  UMUC  
CDD cd03586  PolY_Pol_IV_kappa  
Amino Acid Sequences MTSAESTEQSAHLEDNEDDALKTLKYHLLGPSLTKAGQDKVDQSKVSEIIYNASKGSKFFNREEVRDKILTQKIEQILSRKKKLEQQDLTRDLRNADRLLAELELSRDLTQHIVHLDCDAFFAAVEQLDRPELGDVPFAVGGGVLTTCNYVARQFGCRSGMASFVAKKLCPQLILIKPNFSKYGSKAQEVREVLATYDPRFESASIDEAYLNITEYCDEHRMDPAAVVEQMRKEVHEKTSITVSAGIAANAKLAKICSNINKPNGQYVLPKERNAIMTFMRDLPTRKVNGIGRVLERELLEIGVKTCGDLYEQRQYLNRLFGEKTFVFLLRCYLGLGRTKIQPAEEYERKSVGTESTFHDISDPTKLREKLRSTAEALEKDLRKTEFYTRQVILPKSIYLAEDLYNYSLPMLAKLEQEMPGMRLRLMGLRCTNLVSTKKPDTMAFFGFRPRRQEVGESHDTDIVKRKASEPLEREEEWEKFDEDNEDFGGDLDDNLGDVSHVGEHEEDEDEMLADRRHGKEIVPNPKPEGEAPQPDEWWDCPICLRPQAANERQFNEHIDLCLSRQTIRDAVQADDPKDTKPVLPDVNKRPKLTEKKRGRPPSTDPKQKKLSFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.16
5 0.15
6 0.16
7 0.16
8 0.13
9 0.14
10 0.14
11 0.16
12 0.17
13 0.2
14 0.23
15 0.26
16 0.28
17 0.3
18 0.32
19 0.31
20 0.3
21 0.29
22 0.28
23 0.26
24 0.29
25 0.29
26 0.32
27 0.37
28 0.43
29 0.41
30 0.4
31 0.42
32 0.39
33 0.37
34 0.33
35 0.26
36 0.24
37 0.27
38 0.26
39 0.22
40 0.23
41 0.23
42 0.2
43 0.27
44 0.29
45 0.32
46 0.34
47 0.44
48 0.47
49 0.51
50 0.57
51 0.56
52 0.54
53 0.5
54 0.48
55 0.47
56 0.46
57 0.44
58 0.39
59 0.42
60 0.39
61 0.41
62 0.43
63 0.42
64 0.47
65 0.53
66 0.58
67 0.54
68 0.56
69 0.6
70 0.67
71 0.7
72 0.69
73 0.7
74 0.73
75 0.76
76 0.75
77 0.71
78 0.62
79 0.54
80 0.49
81 0.44
82 0.34
83 0.28
84 0.25
85 0.22
86 0.22
87 0.2
88 0.16
89 0.12
90 0.13
91 0.12
92 0.13
93 0.12
94 0.11
95 0.11
96 0.12
97 0.11
98 0.12
99 0.13
100 0.13
101 0.13
102 0.14
103 0.14
104 0.12
105 0.13
106 0.11
107 0.09
108 0.07
109 0.08
110 0.07
111 0.07
112 0.08
113 0.07
114 0.08
115 0.08
116 0.08
117 0.08
118 0.09
119 0.09
120 0.09
121 0.1
122 0.09
123 0.11
124 0.11
125 0.1
126 0.09
127 0.07
128 0.06
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.05
135 0.06
136 0.06
137 0.07
138 0.1
139 0.11
140 0.17
141 0.18
142 0.21
143 0.23
144 0.23
145 0.23
146 0.21
147 0.21
148 0.17
149 0.19
150 0.17
151 0.18
152 0.2
153 0.18
154 0.19
155 0.23
156 0.22
157 0.2
158 0.2
159 0.26
160 0.31
161 0.4
162 0.39
163 0.41
164 0.4
165 0.42
166 0.42
167 0.35
168 0.32
169 0.27
170 0.37
171 0.33
172 0.37
173 0.39
174 0.4
175 0.46
176 0.43
177 0.41
178 0.32
179 0.3
180 0.26
181 0.25
182 0.24
183 0.16
184 0.19
185 0.18
186 0.16
187 0.17
188 0.16
189 0.14
190 0.14
191 0.16
192 0.13
193 0.14
194 0.13
195 0.12
196 0.12
197 0.1
198 0.1
199 0.06
200 0.06
201 0.06
202 0.06
203 0.09
204 0.11
205 0.11
206 0.11
207 0.13
208 0.14
209 0.14
210 0.14
211 0.12
212 0.11
213 0.11
214 0.11
215 0.11
216 0.1
217 0.13
218 0.12
219 0.13
220 0.14
221 0.16
222 0.18
223 0.23
224 0.23
225 0.22
226 0.25
227 0.24
228 0.23
229 0.2
230 0.17
231 0.14
232 0.14
233 0.12
234 0.1
235 0.09
236 0.1
237 0.08
238 0.08
239 0.06
240 0.06
241 0.07
242 0.08
243 0.12
244 0.17
245 0.25
246 0.3
247 0.34
248 0.37
249 0.36
250 0.39
251 0.37
252 0.32
253 0.28
254 0.28
255 0.35
256 0.35
257 0.35
258 0.32
259 0.32
260 0.33
261 0.31
262 0.27
263 0.17
264 0.16
265 0.17
266 0.17
267 0.16
268 0.15
269 0.16
270 0.17
271 0.21
272 0.2
273 0.19
274 0.23
275 0.24
276 0.28
277 0.29
278 0.28
279 0.25
280 0.25
281 0.25
282 0.21
283 0.19
284 0.15
285 0.11
286 0.09
287 0.08
288 0.07
289 0.07
290 0.06
291 0.06
292 0.05
293 0.05
294 0.05
295 0.06
296 0.08
297 0.11
298 0.17
299 0.18
300 0.19
301 0.21
302 0.24
303 0.24
304 0.26
305 0.23
306 0.18
307 0.19
308 0.18
309 0.22
310 0.2
311 0.19
312 0.16
313 0.17
314 0.14
315 0.14
316 0.15
317 0.09
318 0.1
319 0.09
320 0.08
321 0.1
322 0.13
323 0.15
324 0.16
325 0.18
326 0.19
327 0.19
328 0.19
329 0.19
330 0.19
331 0.26
332 0.28
333 0.29
334 0.29
335 0.3
336 0.29
337 0.28
338 0.24
339 0.18
340 0.15
341 0.13
342 0.14
343 0.17
344 0.17
345 0.17
346 0.17
347 0.15
348 0.15
349 0.21
350 0.19
351 0.18
352 0.24
353 0.27
354 0.3
355 0.37
356 0.4
357 0.38
358 0.42
359 0.43
360 0.39
361 0.42
362 0.44
363 0.37
364 0.36
365 0.36
366 0.33
367 0.3
368 0.31
369 0.25
370 0.22
371 0.24
372 0.3
373 0.32
374 0.34
375 0.39
376 0.36
377 0.39
378 0.43
379 0.41
380 0.36
381 0.28
382 0.25
383 0.21
384 0.21
385 0.17
386 0.13
387 0.13
388 0.11
389 0.1
390 0.11
391 0.11
392 0.1
393 0.1
394 0.08
395 0.09
396 0.08
397 0.08
398 0.1
399 0.1
400 0.1
401 0.12
402 0.14
403 0.13
404 0.14
405 0.14
406 0.14
407 0.15
408 0.15
409 0.14
410 0.13
411 0.12
412 0.16
413 0.17
414 0.2
415 0.19
416 0.2
417 0.21
418 0.21
419 0.21
420 0.22
421 0.25
422 0.24
423 0.28
424 0.31
425 0.33
426 0.33
427 0.34
428 0.33
429 0.34
430 0.34
431 0.3
432 0.26
433 0.32
434 0.37
435 0.38
436 0.39
437 0.39
438 0.38
439 0.37
440 0.42
441 0.38
442 0.41
443 0.45
444 0.41
445 0.39
446 0.4
447 0.38
448 0.34
449 0.38
450 0.32
451 0.28
452 0.26
453 0.26
454 0.31
455 0.36
456 0.43
457 0.38
458 0.42
459 0.45
460 0.44
461 0.46
462 0.43
463 0.39
464 0.33
465 0.31
466 0.26
467 0.21
468 0.21
469 0.22
470 0.18
471 0.18
472 0.16
473 0.14
474 0.12
475 0.12
476 0.12
477 0.08
478 0.07
479 0.06
480 0.06
481 0.05
482 0.05
483 0.05
484 0.04
485 0.04
486 0.05
487 0.05
488 0.05
489 0.06
490 0.06
491 0.07
492 0.08
493 0.09
494 0.08
495 0.08
496 0.08
497 0.08
498 0.09
499 0.1
500 0.09
501 0.1
502 0.15
503 0.17
504 0.2
505 0.2
506 0.21
507 0.28
508 0.38
509 0.46
510 0.47
511 0.48
512 0.49
513 0.5
514 0.51
515 0.43
516 0.42
517 0.38
518 0.41
519 0.43
520 0.42
521 0.4
522 0.4
523 0.41
524 0.34
525 0.32
526 0.24
527 0.19
528 0.19
529 0.24
530 0.27
531 0.29
532 0.31
533 0.29
534 0.36
535 0.46
536 0.52
537 0.55
538 0.56
539 0.56
540 0.56
541 0.55
542 0.5
543 0.45
544 0.38
545 0.3
546 0.28
547 0.24
548 0.22
549 0.26
550 0.23
551 0.2
552 0.21
553 0.24
554 0.25
555 0.27
556 0.31
557 0.28
558 0.29
559 0.35
560 0.38
561 0.36
562 0.39
563 0.37
564 0.33
565 0.34
566 0.33
567 0.28
568 0.27
569 0.32
570 0.35
571 0.42
572 0.51
573 0.59
574 0.69
575 0.73
576 0.71
577 0.7
578 0.71
579 0.74
580 0.75
581 0.75
582 0.75
583 0.79
584 0.88
585 0.93
586 0.89
587 0.86
588 0.85
589 0.85
590 0.85
591 0.86
592 0.83
593 0.81
594 0.85