Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NGR7

Protein Details
Accession A0A395NGR7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-114NHQDKQRDPGQRRVKRKPESGPWEABasic
NLS Segment(s)
PositionSequence
104-105KR
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAPPVSKASSVAPGPSAKVKVPHCTSDPVKADVHETCVGPRAAGSNAVERVRAAPDAGLRLQSRFRFSDRLVTACWGEEDAAAEPVTWTNHQDKQRDPGQRRVKRKPESGPWEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.26
4 0.22
5 0.28
6 0.3
7 0.36
8 0.39
9 0.42
10 0.39
11 0.44
12 0.45
13 0.47
14 0.47
15 0.41
16 0.37
17 0.33
18 0.34
19 0.27
20 0.3
21 0.23
22 0.2
23 0.17
24 0.2
25 0.19
26 0.16
27 0.15
28 0.12
29 0.11
30 0.13
31 0.13
32 0.13
33 0.16
34 0.17
35 0.17
36 0.15
37 0.15
38 0.14
39 0.13
40 0.1
41 0.07
42 0.08
43 0.1
44 0.1
45 0.12
46 0.11
47 0.12
48 0.16
49 0.17
50 0.19
51 0.19
52 0.21
53 0.23
54 0.23
55 0.31
56 0.28
57 0.29
58 0.26
59 0.26
60 0.24
61 0.2
62 0.2
63 0.11
64 0.1
65 0.08
66 0.09
67 0.08
68 0.09
69 0.08
70 0.08
71 0.08
72 0.09
73 0.11
74 0.1
75 0.12
76 0.16
77 0.23
78 0.29
79 0.33
80 0.35
81 0.4
82 0.47
83 0.54
84 0.55
85 0.58
86 0.64
87 0.69
88 0.76
89 0.8
90 0.83
91 0.82
92 0.86
93 0.85
94 0.85