Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395NFH9

Protein Details
Accession A0A395NFH9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-34TTNKVFRVRKASKRTINQDRKWVIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, mito 11.5, cyto_nucl 8.333, mito_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MEATNKASQVTTNKVFRVRKASKRTINQDRKWVITTNNKGSFPTKVNTHPDKASFLAVMVNTRKANILKANILKANIKVNILLKVITEELDSPTMEVGPAVELPAVSWEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.49
4 0.55
5 0.56
6 0.59
7 0.64
8 0.71
9 0.72
10 0.78
11 0.84
12 0.84
13 0.86
14 0.81
15 0.81
16 0.74
17 0.68
18 0.61
19 0.53
20 0.48
21 0.47
22 0.5
23 0.49
24 0.51
25 0.48
26 0.47
27 0.46
28 0.43
29 0.36
30 0.31
31 0.26
32 0.26
33 0.33
34 0.36
35 0.37
36 0.35
37 0.33
38 0.33
39 0.3
40 0.26
41 0.18
42 0.14
43 0.12
44 0.1
45 0.12
46 0.1
47 0.13
48 0.12
49 0.12
50 0.14
51 0.13
52 0.16
53 0.17
54 0.19
55 0.22
56 0.24
57 0.28
58 0.27
59 0.28
60 0.27
61 0.25
62 0.28
63 0.23
64 0.21
65 0.2
66 0.2
67 0.22
68 0.21
69 0.19
70 0.14
71 0.15
72 0.15
73 0.13
74 0.12
75 0.09
76 0.11
77 0.12
78 0.12
79 0.1
80 0.1
81 0.1
82 0.09
83 0.08
84 0.06
85 0.06
86 0.06
87 0.07
88 0.07
89 0.06
90 0.07