Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395NC97

Protein Details
Accession A0A395NC97    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSRPTPRKSRHNRHPSNRIPAISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010334  Dcp1  
IPR011993  PH-like_dom_sf  
Gene Ontology GO:0043229  C:intracellular organelle  
GO:0008047  F:enzyme activator activity  
GO:0000290  P:deadenylation-dependent decapping of nuclear-transcribed mRNA  
GO:0043085  P:positive regulation of catalytic activity  
Pfam View protein in Pfam  
PF06058  DCP1  
CDD cd13182  EVH1-like_Dcp1  
Amino Acid Sequences MSRPTPRKSRHNRHPSNRIPAISDYESDAAAIASTYEPPPPRTNTELNVSVLQRYLPSISRILSIAANAVVYTFDSATQGWEKSGIEGTMFVCAQAPLPEDVNHRPRACVFVLSRRSLDNLIVDLASVGHVEIMGELVILKVEGDWEAGEKVLGLWIHNDEEETRATNGAIIEESWKIARAAGTVSNEGPEAGPAMQAIGRPLTLNELFGRQQEATGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.91
4 0.86
5 0.77
6 0.69
7 0.61
8 0.58
9 0.49
10 0.4
11 0.33
12 0.27
13 0.25
14 0.21
15 0.18
16 0.11
17 0.09
18 0.08
19 0.05
20 0.05
21 0.07
22 0.07
23 0.12
24 0.14
25 0.18
26 0.23
27 0.27
28 0.32
29 0.36
30 0.39
31 0.38
32 0.42
33 0.41
34 0.39
35 0.39
36 0.34
37 0.29
38 0.25
39 0.22
40 0.16
41 0.14
42 0.13
43 0.11
44 0.13
45 0.14
46 0.14
47 0.15
48 0.15
49 0.15
50 0.13
51 0.12
52 0.1
53 0.09
54 0.08
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.08
65 0.09
66 0.09
67 0.09
68 0.1
69 0.1
70 0.1
71 0.11
72 0.09
73 0.07
74 0.08
75 0.08
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.08
84 0.07
85 0.08
86 0.1
87 0.13
88 0.18
89 0.23
90 0.27
91 0.26
92 0.25
93 0.24
94 0.26
95 0.24
96 0.23
97 0.19
98 0.23
99 0.27
100 0.28
101 0.29
102 0.26
103 0.27
104 0.23
105 0.22
106 0.15
107 0.11
108 0.09
109 0.08
110 0.08
111 0.06
112 0.06
113 0.05
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.02
122 0.02
123 0.02
124 0.02
125 0.03
126 0.03
127 0.02
128 0.02
129 0.03
130 0.03
131 0.04
132 0.04
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.07
140 0.07
141 0.06
142 0.07
143 0.09
144 0.1
145 0.1
146 0.11
147 0.09
148 0.1
149 0.11
150 0.12
151 0.11
152 0.11
153 0.11
154 0.12
155 0.11
156 0.1
157 0.1
158 0.08
159 0.09
160 0.09
161 0.1
162 0.09
163 0.1
164 0.1
165 0.1
166 0.11
167 0.09
168 0.12
169 0.15
170 0.18
171 0.19
172 0.19
173 0.19
174 0.18
175 0.18
176 0.15
177 0.11
178 0.1
179 0.08
180 0.08
181 0.07
182 0.08
183 0.09
184 0.09
185 0.1
186 0.1
187 0.1
188 0.1
189 0.11
190 0.16
191 0.16
192 0.17
193 0.17
194 0.21
195 0.22
196 0.22
197 0.26
198 0.2