Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NAQ9

Protein Details
Accession A0A395NAQ9   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-83GEGGDVKKRKIRKRKHKKKKKAPTABasic
NLS Segment(s)
PositionSequence
65-83KKRKIRKRKHKKKKKAPTA
Subcellular Location(s) mito 13, nucl 10, cyto 3
Family & Domain DBs
Gene Ontology GO:0004177  F:aminopeptidase activity  
Amino Acid Sequences MAAKTPSNEHKILNGQGSGKIAGSARANGTVQGNPAEQSGEESDDDPDEHITGFAVAAGEGGDVKKRKIRKRKHKKKKKAPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.29
4 0.29
5 0.25
6 0.19
7 0.17
8 0.13
9 0.14
10 0.14
11 0.14
12 0.13
13 0.14
14 0.14
15 0.14
16 0.16
17 0.14
18 0.13
19 0.13
20 0.13
21 0.11
22 0.11
23 0.1
24 0.08
25 0.09
26 0.09
27 0.09
28 0.08
29 0.09
30 0.09
31 0.09
32 0.09
33 0.08
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.09
50 0.1
51 0.13
52 0.18
53 0.27
54 0.37
55 0.48
56 0.59
57 0.65
58 0.76
59 0.86
60 0.92
61 0.95
62 0.96
63 0.97