Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395N6P6

Protein Details
Accession A0A395N6P6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-149SAGTREPDRKPQPRRRQRVDKRWPRREQRPPTPKKQSRQRKLQEQNASPHydrophilic
NLS Segment(s)
PositionSequence
107-141PDRKPQPRRRQRVDKRWPRREQRPPTPKKQSRQRK
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MQRRLRRLGKAAFAQARSHPTTTQDGECEQRGLGRSKSNGPASADNGPSFTTVQSSPDEDAGATAKDSAPIGYVNAEPLQRNQASPGRDGDGLTAKTSATSAGTREPDRKPQPRRRQRVDKRWPRREQRPPTPKKQSRQRKLQEQNASPLAEQILHSNRSSRRGPPQELWFLGSNGTPCAAVSTKRNWLHFHGDNITEHGVNKALYKVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.51
3 0.51
4 0.47
5 0.43
6 0.36
7 0.33
8 0.37
9 0.38
10 0.36
11 0.32
12 0.3
13 0.32
14 0.32
15 0.29
16 0.23
17 0.22
18 0.23
19 0.25
20 0.26
21 0.27
22 0.29
23 0.34
24 0.42
25 0.42
26 0.42
27 0.42
28 0.42
29 0.4
30 0.42
31 0.38
32 0.31
33 0.28
34 0.25
35 0.22
36 0.19
37 0.15
38 0.12
39 0.11
40 0.13
41 0.13
42 0.15
43 0.15
44 0.15
45 0.15
46 0.12
47 0.12
48 0.11
49 0.1
50 0.08
51 0.07
52 0.07
53 0.07
54 0.08
55 0.07
56 0.07
57 0.06
58 0.07
59 0.08
60 0.08
61 0.08
62 0.1
63 0.11
64 0.11
65 0.12
66 0.17
67 0.15
68 0.16
69 0.18
70 0.21
71 0.21
72 0.22
73 0.23
74 0.2
75 0.2
76 0.19
77 0.17
78 0.17
79 0.16
80 0.15
81 0.14
82 0.11
83 0.11
84 0.11
85 0.09
86 0.06
87 0.06
88 0.07
89 0.1
90 0.13
91 0.14
92 0.19
93 0.2
94 0.28
95 0.36
96 0.44
97 0.51
98 0.59
99 0.69
100 0.75
101 0.83
102 0.84
103 0.88
104 0.89
105 0.9
106 0.91
107 0.91
108 0.91
109 0.92
110 0.92
111 0.89
112 0.89
113 0.88
114 0.87
115 0.87
116 0.87
117 0.85
118 0.85
119 0.88
120 0.85
121 0.83
122 0.84
123 0.84
124 0.83
125 0.86
126 0.85
127 0.85
128 0.86
129 0.86
130 0.85
131 0.77
132 0.74
133 0.66
134 0.58
135 0.47
136 0.38
137 0.29
138 0.2
139 0.17
140 0.16
141 0.17
142 0.18
143 0.18
144 0.24
145 0.26
146 0.31
147 0.34
148 0.34
149 0.4
150 0.46
151 0.52
152 0.53
153 0.58
154 0.59
155 0.57
156 0.55
157 0.46
158 0.38
159 0.33
160 0.28
161 0.21
162 0.15
163 0.14
164 0.11
165 0.09
166 0.12
167 0.13
168 0.14
169 0.18
170 0.23
171 0.33
172 0.38
173 0.41
174 0.41
175 0.45
176 0.51
177 0.51
178 0.51
179 0.46
180 0.44
181 0.42
182 0.43
183 0.4
184 0.32
185 0.28
186 0.23
187 0.2
188 0.18
189 0.18