Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395NDF6

Protein Details
Accession A0A395NDF6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-35RSPSPSRRDRDRGRDAKRNABasic
NLS Segment(s)
PositionSequence
25-28RDRG
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences GSRKPQSNTTARVEARSPSPSRRDRDRGRDAKRNASPSPTRMEQDEYDEDIEVEGQDDDDLAAMQAMMGFGGFGTTKGKKVAGNNAGGVSKEKKSEYRQYMNRQGGFNRPLSPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.41
4 0.38
5 0.36
6 0.44
7 0.49
8 0.53
9 0.6
10 0.65
11 0.68
12 0.74
13 0.78
14 0.79
15 0.8
16 0.83
17 0.78
18 0.78
19 0.75
20 0.71
21 0.61
22 0.59
23 0.54
24 0.47
25 0.49
26 0.41
27 0.36
28 0.32
29 0.34
30 0.27
31 0.29
32 0.28
33 0.24
34 0.21
35 0.2
36 0.18
37 0.14
38 0.13
39 0.08
40 0.06
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.03
59 0.03
60 0.03
61 0.07
62 0.08
63 0.1
64 0.11
65 0.13
66 0.15
67 0.19
68 0.28
69 0.3
70 0.32
71 0.31
72 0.32
73 0.31
74 0.29
75 0.29
76 0.23
77 0.2
78 0.2
79 0.22
80 0.26
81 0.33
82 0.43
83 0.48
84 0.55
85 0.62
86 0.69
87 0.77
88 0.79
89 0.76
90 0.69
91 0.63
92 0.62
93 0.57
94 0.51
95 0.45