Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395NWK6

Protein Details
Accession A0A395NWK6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
199-218EEKEGKKETKREQKGKSYYEBasic
NLS Segment(s)
PositionSequence
177-185RRGPARHGR
201-211EKEGKKETKRE
681-689GAGRKKRKD
Subcellular Location(s) plas 9, nucl 6, mito 5, E.R. 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003323  OTU_dom  
IPR038765  Papain-like_cys_pep_sf  
IPR019400  Peptidase_C65_otubain  
IPR042468  Peptidase_C65_otubain_sub1  
IPR042467  Peptidase_C65_otubain_sub2  
Gene Ontology GO:0016020  C:membrane  
GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF10275  Peptidase_C65  
PROSITE View protein in PROSITE  
PS50802  OTU  
CDD cd22749  Otubain_C65  
Amino Acid Sequences AHLRQRTVQVPRRRPELSSGPLKQPRPGPGRHTLSQLLRAASTRGAPFHSVSTPARPGARIPSLLSSPSPLLFFFSFFQVLFPAAIPEAMFQPQPTPYSASSFSSFSYGLGAAHGLDFLFPTGGAGAXSLPALQLSVSAVGFAAAAAAAAAAAAAPFPPSPAAQSKREPDHQDGGARRGPARHGRAAGCGREVPAGTREEEKEGKKETKREQKGKSYYEIVDADQLLAPSQALPQTYSHYRQIKGDGNCGWRAIAFAYYEKLIDIGDQAQIEGEVARLISLGPMLSNIGRYEYHEDFAEEAHALLRDIAANIANPGLARVILLQRFNDNTVEANIIYYFRMLAATYLKANAAIYDPFVADLGGIASYCSQAIDIVNREIEHLGIVGLANLLLKPIDFVLEIAYLDRSPGSQVNRYRFPEEANQQDTAALGPTLYLLYRPDHYDILYRSPPIQAPPVIPVSVPAPSGPVDLQVNRVSGFTNNIAINTVHSNSAAFATGGMDVLSMLPGFGLNSLSGMGDLSSLSPHTAPSPVGDQYVPSQQPSPSWVPHYPETLPSQVPPQQPPSSLPPVVSPGPMTPSTSMTPSPTMMNATSIRSSSSSTHLPTLVSNVTPVTPTAGYHIRFSPVQLEYEECKRSNFREPPYQTTTSSTFKNSVWNRAHYGNPDFHPEEYVPDDDHSDGRGAGRKKRKDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.63
4 0.6
5 0.61
6 0.59
7 0.62
8 0.68
9 0.67
10 0.65
11 0.62
12 0.63
13 0.6
14 0.61
15 0.57
16 0.6
17 0.65
18 0.62
19 0.62
20 0.59
21 0.57
22 0.58
23 0.55
24 0.46
25 0.4
26 0.38
27 0.34
28 0.29
29 0.29
30 0.24
31 0.22
32 0.23
33 0.24
34 0.25
35 0.26
36 0.26
37 0.27
38 0.27
39 0.32
40 0.32
41 0.33
42 0.34
43 0.31
44 0.32
45 0.35
46 0.37
47 0.33
48 0.31
49 0.33
50 0.33
51 0.34
52 0.32
53 0.27
54 0.24
55 0.23
56 0.21
57 0.17
58 0.19
59 0.18
60 0.19
61 0.17
62 0.18
63 0.18
64 0.17
65 0.18
66 0.14
67 0.15
68 0.13
69 0.12
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.1
76 0.11
77 0.11
78 0.1
79 0.13
80 0.15
81 0.16
82 0.17
83 0.2
84 0.19
85 0.24
86 0.26
87 0.27
88 0.27
89 0.26
90 0.25
91 0.23
92 0.22
93 0.17
94 0.17
95 0.13
96 0.11
97 0.11
98 0.1
99 0.08
100 0.08
101 0.08
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.05
119 0.04
120 0.04
121 0.05
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.05
130 0.03
131 0.03
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.03
142 0.04
143 0.05
144 0.06
145 0.06
146 0.1
147 0.19
148 0.24
149 0.28
150 0.34
151 0.4
152 0.46
153 0.53
154 0.55
155 0.52
156 0.53
157 0.5
158 0.51
159 0.47
160 0.45
161 0.41
162 0.37
163 0.33
164 0.29
165 0.32
166 0.35
167 0.38
168 0.38
169 0.39
170 0.38
171 0.45
172 0.48
173 0.44
174 0.37
175 0.32
176 0.28
177 0.26
178 0.25
179 0.19
180 0.18
181 0.18
182 0.17
183 0.19
184 0.19
185 0.22
186 0.28
187 0.28
188 0.29
189 0.33
190 0.4
191 0.41
192 0.48
193 0.53
194 0.59
195 0.67
196 0.72
197 0.74
198 0.77
199 0.8
200 0.76
201 0.71
202 0.65
203 0.55
204 0.51
205 0.44
206 0.34
207 0.28
208 0.24
209 0.2
210 0.15
211 0.14
212 0.1
213 0.09
214 0.08
215 0.06
216 0.07
217 0.07
218 0.07
219 0.08
220 0.09
221 0.14
222 0.18
223 0.21
224 0.28
225 0.31
226 0.32
227 0.33
228 0.38
229 0.41
230 0.39
231 0.4
232 0.37
233 0.36
234 0.36
235 0.34
236 0.28
237 0.21
238 0.19
239 0.15
240 0.11
241 0.08
242 0.08
243 0.09
244 0.09
245 0.09
246 0.09
247 0.08
248 0.07
249 0.06
250 0.06
251 0.06
252 0.07
253 0.07
254 0.07
255 0.07
256 0.07
257 0.06
258 0.06
259 0.05
260 0.03
261 0.03
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.04
271 0.04
272 0.05
273 0.05
274 0.07
275 0.07
276 0.09
277 0.15
278 0.15
279 0.16
280 0.16
281 0.16
282 0.14
283 0.14
284 0.13
285 0.07
286 0.06
287 0.06
288 0.06
289 0.05
290 0.05
291 0.05
292 0.04
293 0.05
294 0.05
295 0.05
296 0.05
297 0.05
298 0.05
299 0.05
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.07
307 0.09
308 0.11
309 0.11
310 0.12
311 0.13
312 0.14
313 0.14
314 0.11
315 0.1
316 0.1
317 0.1
318 0.09
319 0.08
320 0.07
321 0.07
322 0.07
323 0.06
324 0.05
325 0.04
326 0.04
327 0.04
328 0.05
329 0.06
330 0.07
331 0.07
332 0.07
333 0.07
334 0.07
335 0.07
336 0.07
337 0.06
338 0.06
339 0.06
340 0.06
341 0.06
342 0.06
343 0.06
344 0.05
345 0.04
346 0.04
347 0.04
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.03
354 0.03
355 0.03
356 0.04
357 0.04
358 0.06
359 0.08
360 0.08
361 0.09
362 0.09
363 0.1
364 0.1
365 0.09
366 0.07
367 0.06
368 0.05
369 0.04
370 0.04
371 0.03
372 0.03
373 0.03
374 0.03
375 0.03
376 0.03
377 0.03
378 0.03
379 0.03
380 0.03
381 0.04
382 0.04
383 0.04
384 0.05
385 0.06
386 0.06
387 0.06
388 0.07
389 0.06
390 0.06
391 0.06
392 0.05
393 0.06
394 0.09
395 0.12
396 0.18
397 0.23
398 0.29
399 0.36
400 0.39
401 0.39
402 0.36
403 0.36
404 0.37
405 0.37
406 0.38
407 0.34
408 0.32
409 0.3
410 0.3
411 0.27
412 0.19
413 0.15
414 0.08
415 0.05
416 0.04
417 0.04
418 0.04
419 0.04
420 0.04
421 0.05
422 0.07
423 0.09
424 0.11
425 0.13
426 0.13
427 0.14
428 0.18
429 0.19
430 0.23
431 0.23
432 0.22
433 0.21
434 0.22
435 0.22
436 0.2
437 0.22
438 0.17
439 0.17
440 0.19
441 0.2
442 0.18
443 0.17
444 0.16
445 0.14
446 0.13
447 0.12
448 0.09
449 0.09
450 0.09
451 0.1
452 0.09
453 0.1
454 0.11
455 0.11
456 0.15
457 0.16
458 0.16
459 0.15
460 0.15
461 0.14
462 0.13
463 0.15
464 0.12
465 0.14
466 0.14
467 0.14
468 0.15
469 0.14
470 0.15
471 0.15
472 0.15
473 0.11
474 0.11
475 0.11
476 0.1
477 0.11
478 0.09
479 0.07
480 0.06
481 0.06
482 0.07
483 0.06
484 0.06
485 0.05
486 0.04
487 0.04
488 0.05
489 0.04
490 0.03
491 0.03
492 0.03
493 0.03
494 0.04
495 0.05
496 0.04
497 0.05
498 0.05
499 0.05
500 0.05
501 0.05
502 0.05
503 0.04
504 0.05
505 0.05
506 0.05
507 0.05
508 0.06
509 0.06
510 0.07
511 0.08
512 0.09
513 0.09
514 0.11
515 0.14
516 0.14
517 0.15
518 0.15
519 0.15
520 0.16
521 0.24
522 0.23
523 0.21
524 0.22
525 0.21
526 0.22
527 0.27
528 0.29
529 0.24
530 0.29
531 0.31
532 0.34
533 0.36
534 0.39
535 0.35
536 0.35
537 0.36
538 0.33
539 0.31
540 0.26
541 0.29
542 0.32
543 0.35
544 0.35
545 0.38
546 0.37
547 0.38
548 0.41
549 0.42
550 0.43
551 0.39
552 0.36
553 0.31
554 0.33
555 0.32
556 0.29
557 0.23
558 0.17
559 0.21
560 0.21
561 0.22
562 0.18
563 0.21
564 0.21
565 0.23
566 0.23
567 0.21
568 0.22
569 0.21
570 0.21
571 0.18
572 0.2
573 0.18
574 0.21
575 0.19
576 0.21
577 0.21
578 0.2
579 0.21
580 0.19
581 0.21
582 0.19
583 0.22
584 0.24
585 0.25
586 0.27
587 0.26
588 0.26
589 0.24
590 0.26
591 0.23
592 0.19
593 0.17
594 0.15
595 0.15
596 0.15
597 0.14
598 0.14
599 0.12
600 0.12
601 0.16
602 0.22
603 0.23
604 0.25
605 0.27
606 0.27
607 0.26
608 0.28
609 0.29
610 0.24
611 0.25
612 0.23
613 0.26
614 0.26
615 0.33
616 0.37
617 0.31
618 0.33
619 0.36
620 0.39
621 0.45
622 0.49
623 0.5
624 0.55
625 0.61
626 0.65
627 0.68
628 0.68
629 0.59
630 0.56
631 0.54
632 0.47
633 0.44
634 0.4
635 0.35
636 0.33
637 0.41
638 0.4
639 0.44
640 0.47
641 0.49
642 0.5
643 0.51
644 0.55
645 0.51
646 0.53
647 0.5
648 0.45
649 0.49
650 0.45
651 0.42
652 0.42
653 0.35
654 0.34
655 0.31
656 0.31
657 0.24
658 0.24
659 0.25
660 0.22
661 0.23
662 0.2
663 0.17
664 0.16
665 0.18
666 0.24
667 0.27
668 0.35
669 0.45