Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395SX65

Protein Details
Accession A0A395SX65    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-27CGGGMSGHRRRKARRRNQAIAEWTHydrophilic
NLS Segment(s)
PositionSequence
11-19HRRRKARRR
Subcellular Location(s) mito 17, nucl 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MGCCGGGMSGHRRRKARRRNQAIAEWTAGAKAWSESYQQPEHSWRHNPTPEMVAAKEEAYRQAYREQIELARARGEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.78
4 0.8
5 0.83
6 0.86
7 0.86
8 0.84
9 0.78
10 0.7
11 0.6
12 0.49
13 0.39
14 0.3
15 0.23
16 0.14
17 0.09
18 0.07
19 0.06
20 0.07
21 0.09
22 0.11
23 0.16
24 0.17
25 0.18
26 0.19
27 0.23
28 0.25
29 0.27
30 0.31
31 0.3
32 0.36
33 0.39
34 0.38
35 0.35
36 0.35
37 0.33
38 0.29
39 0.26
40 0.2
41 0.17
42 0.17
43 0.16
44 0.14
45 0.15
46 0.17
47 0.17
48 0.18
49 0.22
50 0.25
51 0.25
52 0.26
53 0.26
54 0.24
55 0.3
56 0.31
57 0.28