Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395RW81

Protein Details
Accession A0A395RW81    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
430-449SSRGRRSRDRLPPSRLSRSYHydrophilic
464-483EDFRHARRARDDRDRERDREBasic
531-557DYPGWDPRSERKRWDKRMPPEERGTSPBasic
NLS Segment(s)
PositionSequence
469-549ARRARDDRDRERDRERERERIRDRGRQRELDREREEERRERYLRRPEMERRTSSHADAERRRDYPGWDPRSERKRWDKRMP
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAAPPTTEAPPAPGATSSTPPPPPIEYTYMYEKDKSPSKLLDALLRSIGLHIILEIGDRNVCHLTPEKMAAFYKAVGGDYDSLFEMPHESISYIWQVTGCQHTLQPTHDDFEPPSIPALTFRGFSRWESLEILLGPEEHVPFLQFAVKNWQLKHPETGQEFPPDLPATVFPTQPDVEVDRWHKSCAEKLRKEANAREREAFREAAREPTGPGEPGDGPEPKFAYSHVRGSAFAGNRARPAPERPLYNHVPGRHAGTRPARPSPERYNSHADEHARRRSFSDYHQQPSPDVPPHPHRGPSDTYLDPNTKRPAPARRHSQPRHYSSESSDDEPVPPRARKRSEVSPPSPTSRRYSPTNDRPPPVASNPPPAFRPHRADVRTDESTRRRSTHSPSLREKLSEKVSNILPNGLTSNAPDRNRNAPRTASYNTDSSRGRRSRDRLPPSRLSRSYSDISVESSEAESSDEDFRHARRARDDRDRERDRERERERIRDRGRQRELDREREEERRERYLRRPEMERRTSSHADAERRRDYPGWDPRSERKRWDKRMPPEERGTSPLATPSRRPVPASGVAERMGTGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.25
5 0.28
6 0.29
7 0.3
8 0.32
9 0.33
10 0.34
11 0.36
12 0.38
13 0.35
14 0.38
15 0.44
16 0.46
17 0.45
18 0.43
19 0.4
20 0.41
21 0.46
22 0.46
23 0.43
24 0.42
25 0.44
26 0.47
27 0.46
28 0.47
29 0.42
30 0.4
31 0.35
32 0.32
33 0.28
34 0.22
35 0.21
36 0.13
37 0.1
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.08
44 0.09
45 0.09
46 0.11
47 0.12
48 0.12
49 0.15
50 0.18
51 0.2
52 0.22
53 0.27
54 0.26
55 0.27
56 0.28
57 0.28
58 0.25
59 0.23
60 0.22
61 0.19
62 0.18
63 0.15
64 0.16
65 0.15
66 0.14
67 0.15
68 0.12
69 0.11
70 0.11
71 0.11
72 0.11
73 0.09
74 0.1
75 0.09
76 0.09
77 0.09
78 0.12
79 0.14
80 0.12
81 0.12
82 0.11
83 0.11
84 0.14
85 0.18
86 0.17
87 0.16
88 0.17
89 0.21
90 0.23
91 0.25
92 0.28
93 0.25
94 0.27
95 0.27
96 0.28
97 0.24
98 0.27
99 0.26
100 0.2
101 0.2
102 0.18
103 0.17
104 0.16
105 0.19
106 0.15
107 0.15
108 0.15
109 0.18
110 0.19
111 0.2
112 0.24
113 0.22
114 0.23
115 0.24
116 0.23
117 0.21
118 0.2
119 0.19
120 0.14
121 0.13
122 0.11
123 0.11
124 0.1
125 0.09
126 0.09
127 0.08
128 0.08
129 0.09
130 0.14
131 0.12
132 0.13
133 0.22
134 0.27
135 0.31
136 0.32
137 0.39
138 0.38
139 0.4
140 0.44
141 0.4
142 0.42
143 0.41
144 0.43
145 0.39
146 0.38
147 0.37
148 0.31
149 0.3
150 0.24
151 0.2
152 0.18
153 0.16
154 0.17
155 0.18
156 0.18
157 0.15
158 0.18
159 0.18
160 0.18
161 0.19
162 0.16
163 0.16
164 0.21
165 0.24
166 0.26
167 0.27
168 0.27
169 0.28
170 0.27
171 0.32
172 0.37
173 0.45
174 0.43
175 0.49
176 0.57
177 0.6
178 0.64
179 0.65
180 0.65
181 0.62
182 0.61
183 0.59
184 0.52
185 0.49
186 0.47
187 0.4
188 0.31
189 0.27
190 0.25
191 0.25
192 0.25
193 0.23
194 0.2
195 0.21
196 0.21
197 0.17
198 0.16
199 0.14
200 0.12
201 0.13
202 0.15
203 0.15
204 0.15
205 0.16
206 0.17
207 0.15
208 0.14
209 0.14
210 0.19
211 0.2
212 0.23
213 0.24
214 0.24
215 0.24
216 0.26
217 0.3
218 0.23
219 0.26
220 0.25
221 0.22
222 0.23
223 0.24
224 0.23
225 0.2
226 0.23
227 0.26
228 0.26
229 0.29
230 0.31
231 0.37
232 0.38
233 0.42
234 0.43
235 0.36
236 0.35
237 0.32
238 0.34
239 0.31
240 0.28
241 0.29
242 0.31
243 0.36
244 0.37
245 0.4
246 0.39
247 0.37
248 0.43
249 0.45
250 0.48
251 0.46
252 0.48
253 0.5
254 0.49
255 0.49
256 0.46
257 0.41
258 0.4
259 0.42
260 0.45
261 0.4
262 0.38
263 0.37
264 0.38
265 0.36
266 0.33
267 0.37
268 0.34
269 0.37
270 0.39
271 0.37
272 0.33
273 0.34
274 0.33
275 0.25
276 0.21
277 0.21
278 0.24
279 0.3
280 0.31
281 0.33
282 0.3
283 0.31
284 0.33
285 0.32
286 0.32
287 0.26
288 0.26
289 0.25
290 0.28
291 0.25
292 0.26
293 0.27
294 0.23
295 0.24
296 0.28
297 0.35
298 0.39
299 0.46
300 0.51
301 0.56
302 0.65
303 0.68
304 0.73
305 0.73
306 0.7
307 0.7
308 0.64
309 0.58
310 0.49
311 0.53
312 0.44
313 0.37
314 0.33
315 0.26
316 0.24
317 0.25
318 0.26
319 0.22
320 0.23
321 0.26
322 0.32
323 0.35
324 0.39
325 0.42
326 0.48
327 0.54
328 0.6
329 0.59
330 0.6
331 0.59
332 0.59
333 0.57
334 0.51
335 0.45
336 0.42
337 0.41
338 0.38
339 0.44
340 0.48
341 0.56
342 0.64
343 0.64
344 0.61
345 0.59
346 0.57
347 0.53
348 0.47
349 0.44
350 0.36
351 0.41
352 0.41
353 0.4
354 0.38
355 0.38
356 0.41
357 0.38
358 0.43
359 0.38
360 0.44
361 0.44
362 0.46
363 0.47
364 0.47
365 0.46
366 0.42
367 0.44
368 0.42
369 0.47
370 0.47
371 0.45
372 0.43
373 0.43
374 0.48
375 0.52
376 0.54
377 0.56
378 0.59
379 0.63
380 0.6
381 0.57
382 0.51
383 0.47
384 0.45
385 0.42
386 0.35
387 0.34
388 0.35
389 0.36
390 0.35
391 0.3
392 0.23
393 0.19
394 0.19
395 0.16
396 0.13
397 0.11
398 0.17
399 0.21
400 0.23
401 0.25
402 0.28
403 0.37
404 0.44
405 0.46
406 0.44
407 0.41
408 0.43
409 0.46
410 0.44
411 0.4
412 0.35
413 0.37
414 0.34
415 0.35
416 0.34
417 0.32
418 0.4
419 0.39
420 0.41
421 0.45
422 0.49
423 0.54
424 0.63
425 0.7
426 0.69
427 0.73
428 0.78
429 0.77
430 0.81
431 0.74
432 0.68
433 0.61
434 0.58
435 0.52
436 0.43
437 0.38
438 0.29
439 0.28
440 0.24
441 0.21
442 0.16
443 0.14
444 0.12
445 0.1
446 0.1
447 0.09
448 0.1
449 0.13
450 0.12
451 0.13
452 0.15
453 0.16
454 0.25
455 0.29
456 0.31
457 0.37
458 0.46
459 0.53
460 0.62
461 0.71
462 0.71
463 0.78
464 0.81
465 0.77
466 0.76
467 0.78
468 0.74
469 0.74
470 0.7
471 0.7
472 0.69
473 0.75
474 0.72
475 0.74
476 0.74
477 0.73
478 0.77
479 0.77
480 0.79
481 0.77
482 0.76
483 0.76
484 0.76
485 0.76
486 0.72
487 0.66
488 0.62
489 0.61
490 0.63
491 0.6
492 0.58
493 0.58
494 0.58
495 0.6
496 0.65
497 0.67
498 0.7
499 0.68
500 0.71
501 0.71
502 0.77
503 0.79
504 0.75
505 0.69
506 0.69
507 0.66
508 0.6
509 0.58
510 0.54
511 0.54
512 0.58
513 0.61
514 0.59
515 0.56
516 0.58
517 0.52
518 0.5
519 0.51
520 0.54
521 0.52
522 0.51
523 0.56
524 0.62
525 0.68
526 0.69
527 0.69
528 0.7
529 0.73
530 0.78
531 0.83
532 0.84
533 0.86
534 0.92
535 0.9
536 0.87
537 0.86
538 0.82
539 0.74
540 0.69
541 0.62
542 0.52
543 0.44
544 0.44
545 0.4
546 0.37
547 0.38
548 0.42
549 0.47
550 0.48
551 0.5
552 0.46
553 0.47
554 0.52
555 0.55
556 0.49
557 0.44
558 0.42
559 0.39