Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395T125

Protein Details
Accession A0A395T125    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSRFTRSLRLPRPKVRSTRPELDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 6, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013862  Kei1  
Gene Ontology GO:0016020  C:membrane  
GO:0070917  F:inositol phosphoceramide synthase regulator activity  
GO:0006673  P:inositol phosphoceramide metabolic process  
Pfam View protein in Pfam  
PF08552  Kei1  
Amino Acid Sequences MSRFTRSLRLPRPKVRSTRPELDSVSLFGITSLQTGTELISLALVFNKITGVYGLLAILTGYQLSLLQLSTYVYSIAVLVGLAILTPHVRRQSPFECLALAWLYMIDTVINAAYTAAFGLDWYFSTQLNETIEAKKTDLPNFVAEGMQGLRKEAAMHGKVVPQETAASMLLIVGATLIRVYFSFVVMAYAKQVLQKYMQLMILEGPGVDDQEGPFAEDLPDGEGRRGRLGRLMVSCGRAYWLDTRESDEWAPSLGGSSKPAAAGTLSGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.82
5 0.82
6 0.76
7 0.73
8 0.67
9 0.61
10 0.52
11 0.44
12 0.36
13 0.26
14 0.23
15 0.16
16 0.14
17 0.1
18 0.09
19 0.07
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.05
61 0.06
62 0.06
63 0.05
64 0.05
65 0.04
66 0.03
67 0.03
68 0.03
69 0.02
70 0.02
71 0.03
72 0.04
73 0.04
74 0.08
75 0.11
76 0.12
77 0.14
78 0.21
79 0.24
80 0.29
81 0.3
82 0.28
83 0.25
84 0.24
85 0.24
86 0.18
87 0.14
88 0.09
89 0.06
90 0.06
91 0.05
92 0.05
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.02
105 0.03
106 0.03
107 0.03
108 0.04
109 0.05
110 0.06
111 0.06
112 0.07
113 0.07
114 0.09
115 0.09
116 0.1
117 0.11
118 0.12
119 0.14
120 0.14
121 0.14
122 0.16
123 0.18
124 0.18
125 0.19
126 0.19
127 0.18
128 0.18
129 0.18
130 0.14
131 0.12
132 0.1
133 0.09
134 0.09
135 0.08
136 0.07
137 0.07
138 0.07
139 0.08
140 0.08
141 0.14
142 0.13
143 0.15
144 0.15
145 0.18
146 0.19
147 0.19
148 0.18
149 0.12
150 0.11
151 0.1
152 0.11
153 0.09
154 0.07
155 0.06
156 0.06
157 0.06
158 0.05
159 0.04
160 0.03
161 0.02
162 0.02
163 0.02
164 0.02
165 0.03
166 0.03
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.08
173 0.09
174 0.09
175 0.08
176 0.09
177 0.09
178 0.12
179 0.12
180 0.12
181 0.13
182 0.16
183 0.16
184 0.18
185 0.19
186 0.16
187 0.16
188 0.15
189 0.14
190 0.11
191 0.09
192 0.08
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.08
199 0.08
200 0.08
201 0.08
202 0.09
203 0.09
204 0.09
205 0.09
206 0.1
207 0.13
208 0.13
209 0.15
210 0.17
211 0.18
212 0.24
213 0.25
214 0.23
215 0.25
216 0.27
217 0.3
218 0.3
219 0.35
220 0.31
221 0.33
222 0.33
223 0.28
224 0.27
225 0.22
226 0.22
227 0.23
228 0.23
229 0.23
230 0.24
231 0.3
232 0.29
233 0.33
234 0.31
235 0.26
236 0.24
237 0.21
238 0.2
239 0.14
240 0.15
241 0.13
242 0.14
243 0.15
244 0.16
245 0.16
246 0.16
247 0.16
248 0.15
249 0.13
250 0.13