Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395SZV0

Protein Details
Accession A0A395SZV0   
Localization Confidence Low
Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-36VSGNENSKQRRRKTAENLAPPFFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 2, cyto_nucl 2, E.R. 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034907  NDK-like_dom  
IPR036850  NDK-like_dom_sf  
IPR001564  Nucleoside_diP_kinase  
IPR023005  Nucleoside_diP_kinase_AS  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0004550  F:nucleoside diphosphate kinase activity  
GO:0006241  P:CTP biosynthetic process  
GO:0006183  P:GTP biosynthetic process  
GO:0016310  P:phosphorylation  
GO:0006228  P:UTP biosynthetic process  
Pfam View protein in Pfam  
PF00334  NDK  
PROSITE View protein in PROSITE  
PS00469  NDP_KINASES  
CDD cd04413  NDPk_I  
Amino Acid Sequences MAAEEPRQRKDPAVSGNENSKQRRRKTAENLAPPFFALLFALLAFYILFSPPSSSLSPPVPVCHSTSVSSVSSSQVIPDKNIAKMSSSEQTFIAIKPDGVQRGLVGPIISRFENRGFKLAAIKLVTPGKEHLEKHYADLAGKPFFPGLIEYMNSGPICAMVWEGRDAVKTGRAILGATNPLASSPGTIRGDYAIDVGRNVCHGSDSVENAQKEIALWFKEGEVVSWKSAQFGWVYEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.59
4 0.62
5 0.63
6 0.63
7 0.63
8 0.64
9 0.65
10 0.72
11 0.71
12 0.74
13 0.77
14 0.81
15 0.82
16 0.83
17 0.82
18 0.74
19 0.67
20 0.56
21 0.46
22 0.35
23 0.25
24 0.15
25 0.09
26 0.07
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.05
36 0.05
37 0.08
38 0.08
39 0.12
40 0.13
41 0.14
42 0.17
43 0.19
44 0.22
45 0.21
46 0.22
47 0.22
48 0.22
49 0.24
50 0.24
51 0.24
52 0.22
53 0.23
54 0.24
55 0.21
56 0.2
57 0.18
58 0.16
59 0.15
60 0.13
61 0.13
62 0.14
63 0.14
64 0.14
65 0.19
66 0.2
67 0.2
68 0.22
69 0.21
70 0.18
71 0.19
72 0.21
73 0.21
74 0.2
75 0.19
76 0.17
77 0.19
78 0.18
79 0.17
80 0.16
81 0.11
82 0.1
83 0.11
84 0.14
85 0.13
86 0.13
87 0.13
88 0.1
89 0.11
90 0.11
91 0.1
92 0.07
93 0.06
94 0.07
95 0.09
96 0.09
97 0.08
98 0.09
99 0.13
100 0.18
101 0.18
102 0.2
103 0.18
104 0.19
105 0.22
106 0.21
107 0.19
108 0.16
109 0.15
110 0.16
111 0.17
112 0.17
113 0.14
114 0.15
115 0.15
116 0.19
117 0.2
118 0.21
119 0.23
120 0.23
121 0.25
122 0.27
123 0.24
124 0.2
125 0.22
126 0.21
127 0.17
128 0.17
129 0.15
130 0.11
131 0.1
132 0.1
133 0.09
134 0.07
135 0.08
136 0.08
137 0.09
138 0.09
139 0.12
140 0.11
141 0.1
142 0.09
143 0.07
144 0.07
145 0.06
146 0.07
147 0.05
148 0.06
149 0.07
150 0.08
151 0.08
152 0.09
153 0.1
154 0.1
155 0.13
156 0.12
157 0.13
158 0.13
159 0.13
160 0.13
161 0.13
162 0.15
163 0.13
164 0.12
165 0.12
166 0.1
167 0.1
168 0.11
169 0.1
170 0.08
171 0.08
172 0.15
173 0.17
174 0.17
175 0.17
176 0.18
177 0.18
178 0.17
179 0.18
180 0.12
181 0.11
182 0.12
183 0.12
184 0.11
185 0.12
186 0.12
187 0.1
188 0.09
189 0.09
190 0.12
191 0.14
192 0.18
193 0.23
194 0.29
195 0.29
196 0.29
197 0.28
198 0.25
199 0.23
200 0.2
201 0.19
202 0.14
203 0.15
204 0.15
205 0.15
206 0.19
207 0.19
208 0.18
209 0.2
210 0.21
211 0.22
212 0.25
213 0.25
214 0.22
215 0.23
216 0.23
217 0.18
218 0.18