Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395T4G8

Protein Details
Accession A0A395T4G8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
363-382AVNPRKRKGTDIFMKPKRRABasic
NLS Segment(s)
PositionSequence
356-382SAARPPPAVNPRKRKGTDIFMKPKRRA
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR010684  RNA_pol_II_trans_fac_SIII_A  
Gene Ontology GO:0070449  C:elongin complex  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF06881  Elongin_A  
Amino Acid Sequences MPAKSLLELATTACIKNIRELDSVGTLLPYKTVRTVLLKIDNAKQLRLIETNSPQIQGETGEVWLKIIKHEFPMELRQKAYKPTNPTKWYRVYDKYKAAHQKALDESEAKLKSAFIGLQQDRAKTKTMIVDDRRLLPQGGRVGPKKPWGFGARDPNGSTLAFTRGSRTKTNTGASVMRKVRRETKEIASIHGKLSRPTQSSNAITRLQKAPAAMINDYQRASKPAIRAPLPKPTASEVVEAHEERAQYITDSDSDGGGGEDLFDDDHSPPRKVASRPSSFAPRRSSPGPSKPTSSVRRSGLLSNSYKGPKPQAAATPSQPRSSRPVKQEKTSPVPERRVLSSSPEAGPSPSPPPASAARPPPAVNPRKRKGTDIFMKPKRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.26
4 0.3
5 0.3
6 0.3
7 0.31
8 0.32
9 0.31
10 0.31
11 0.24
12 0.2
13 0.17
14 0.15
15 0.17
16 0.15
17 0.14
18 0.16
19 0.17
20 0.2
21 0.24
22 0.28
23 0.32
24 0.39
25 0.41
26 0.43
27 0.47
28 0.51
29 0.48
30 0.45
31 0.41
32 0.35
33 0.35
34 0.34
35 0.3
36 0.3
37 0.32
38 0.39
39 0.37
40 0.36
41 0.32
42 0.3
43 0.27
44 0.21
45 0.19
46 0.11
47 0.12
48 0.12
49 0.12
50 0.12
51 0.14
52 0.13
53 0.15
54 0.17
55 0.18
56 0.19
57 0.22
58 0.23
59 0.24
60 0.34
61 0.38
62 0.37
63 0.38
64 0.39
65 0.39
66 0.45
67 0.5
68 0.47
69 0.49
70 0.56
71 0.64
72 0.67
73 0.71
74 0.7
75 0.7
76 0.69
77 0.67
78 0.67
79 0.65
80 0.66
81 0.68
82 0.64
83 0.64
84 0.69
85 0.65
86 0.6
87 0.53
88 0.51
89 0.46
90 0.46
91 0.39
92 0.3
93 0.28
94 0.3
95 0.3
96 0.24
97 0.2
98 0.17
99 0.16
100 0.16
101 0.16
102 0.1
103 0.19
104 0.19
105 0.27
106 0.29
107 0.31
108 0.31
109 0.32
110 0.32
111 0.24
112 0.26
113 0.24
114 0.26
115 0.32
116 0.34
117 0.39
118 0.38
119 0.41
120 0.4
121 0.35
122 0.32
123 0.23
124 0.24
125 0.23
126 0.25
127 0.27
128 0.28
129 0.29
130 0.32
131 0.39
132 0.36
133 0.31
134 0.32
135 0.31
136 0.33
137 0.37
138 0.45
139 0.4
140 0.41
141 0.41
142 0.37
143 0.35
144 0.3
145 0.24
146 0.15
147 0.14
148 0.13
149 0.12
150 0.15
151 0.18
152 0.22
153 0.24
154 0.28
155 0.3
156 0.32
157 0.34
158 0.31
159 0.3
160 0.31
161 0.3
162 0.33
163 0.34
164 0.34
165 0.36
166 0.37
167 0.43
168 0.42
169 0.45
170 0.41
171 0.41
172 0.45
173 0.42
174 0.43
175 0.37
176 0.34
177 0.31
178 0.31
179 0.26
180 0.19
181 0.23
182 0.25
183 0.23
184 0.24
185 0.26
186 0.27
187 0.3
188 0.31
189 0.31
190 0.3
191 0.29
192 0.3
193 0.29
194 0.25
195 0.23
196 0.2
197 0.18
198 0.16
199 0.18
200 0.15
201 0.16
202 0.17
203 0.18
204 0.18
205 0.17
206 0.15
207 0.15
208 0.17
209 0.18
210 0.19
211 0.2
212 0.25
213 0.28
214 0.34
215 0.34
216 0.41
217 0.4
218 0.38
219 0.36
220 0.34
221 0.35
222 0.3
223 0.29
224 0.2
225 0.2
226 0.22
227 0.21
228 0.19
229 0.16
230 0.15
231 0.13
232 0.13
233 0.11
234 0.08
235 0.09
236 0.09
237 0.07
238 0.09
239 0.09
240 0.08
241 0.08
242 0.07
243 0.07
244 0.06
245 0.05
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.06
252 0.06
253 0.13
254 0.16
255 0.17
256 0.17
257 0.21
258 0.27
259 0.28
260 0.37
261 0.4
262 0.44
263 0.45
264 0.5
265 0.57
266 0.54
267 0.59
268 0.56
269 0.5
270 0.49
271 0.5
272 0.53
273 0.51
274 0.57
275 0.58
276 0.53
277 0.54
278 0.54
279 0.6
280 0.61
281 0.58
282 0.55
283 0.51
284 0.52
285 0.49
286 0.48
287 0.45
288 0.44
289 0.41
290 0.37
291 0.4
292 0.39
293 0.39
294 0.37
295 0.38
296 0.34
297 0.34
298 0.36
299 0.38
300 0.39
301 0.42
302 0.46
303 0.5
304 0.49
305 0.53
306 0.49
307 0.44
308 0.48
309 0.51
310 0.52
311 0.52
312 0.61
313 0.61
314 0.67
315 0.73
316 0.74
317 0.74
318 0.76
319 0.75
320 0.73
321 0.74
322 0.72
323 0.67
324 0.62
325 0.57
326 0.49
327 0.46
328 0.43
329 0.4
330 0.37
331 0.35
332 0.32
333 0.3
334 0.31
335 0.27
336 0.25
337 0.26
338 0.26
339 0.24
340 0.27
341 0.3
342 0.34
343 0.37
344 0.41
345 0.42
346 0.44
347 0.45
348 0.49
349 0.55
350 0.6
351 0.63
352 0.66
353 0.69
354 0.76
355 0.78
356 0.77
357 0.73
358 0.74
359 0.74
360 0.74
361 0.77
362 0.76