Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395SYR8

Protein Details
Accession A0A395SYR8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-125RVGSRCKKCNDAEKERQKKKDKEKRDAYNKNKDKKBasic
NLS Segment(s)
PositionSequence
104-125KERQKKKDKEKRDAYNKNKDKK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MLSTDELLNPSEDPAVAGSSNNDNVVTQPERPEDPDEPNRPNKCWDCPRPAVEGMLRCASCIKKANNGQKKMRKEREAAGTCKTCGKPKDRVGSRCKKCNDAEKERQKKKDKEKRDAYNKNKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.09
5 0.11
6 0.13
7 0.14
8 0.14
9 0.13
10 0.12
11 0.12
12 0.18
13 0.18
14 0.16
15 0.18
16 0.2
17 0.22
18 0.24
19 0.29
20 0.26
21 0.31
22 0.39
23 0.41
24 0.44
25 0.51
26 0.52
27 0.48
28 0.53
29 0.49
30 0.49
31 0.53
32 0.54
33 0.53
34 0.56
35 0.57
36 0.54
37 0.51
38 0.45
39 0.38
40 0.33
41 0.27
42 0.26
43 0.22
44 0.18
45 0.2
46 0.18
47 0.18
48 0.22
49 0.21
50 0.25
51 0.33
52 0.43
53 0.5
54 0.56
55 0.62
56 0.64
57 0.73
58 0.75
59 0.76
60 0.71
61 0.66
62 0.64
63 0.66
64 0.63
65 0.57
66 0.53
67 0.46
68 0.42
69 0.45
70 0.4
71 0.36
72 0.36
73 0.38
74 0.41
75 0.47
76 0.57
77 0.6
78 0.67
79 0.71
80 0.76
81 0.79
82 0.79
83 0.74
84 0.7
85 0.67
86 0.69
87 0.69
88 0.68
89 0.72
90 0.74
91 0.81
92 0.84
93 0.88
94 0.88
95 0.88
96 0.89
97 0.89
98 0.89
99 0.89
100 0.9
101 0.91
102 0.92
103 0.93
104 0.92
105 0.92