Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395SZS8

Protein Details
Accession A0A395SZS8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-53ENKYGPARVIRRRRSRAGRRGPPGSHBasic
NLS Segment(s)
PositionSequence
34-50ARVIRRRRSRAGRRGPP
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MASCIYRDASSYAPVFPSPLNPTSHGPENKYGPARVIRRRRSRAGRRGPPGSHTLTQRFLRVKAADAWRGHVLSAQVAQYEYAEAAAMGVITETKNRNCCPSMPGLKNLGLNFSLSDAHHIASRIRLPDLLCLKTRRMLLAMGLVGLLPALKVRDMLRAAESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.17
4 0.2
5 0.21
6 0.24
7 0.26
8 0.27
9 0.31
10 0.35
11 0.43
12 0.42
13 0.4
14 0.42
15 0.43
16 0.47
17 0.46
18 0.42
19 0.36
20 0.41
21 0.45
22 0.49
23 0.55
24 0.59
25 0.66
26 0.73
27 0.79
28 0.82
29 0.85
30 0.86
31 0.86
32 0.86
33 0.83
34 0.83
35 0.75
36 0.67
37 0.61
38 0.56
39 0.49
40 0.44
41 0.39
42 0.38
43 0.38
44 0.39
45 0.36
46 0.31
47 0.32
48 0.29
49 0.27
50 0.28
51 0.31
52 0.32
53 0.3
54 0.32
55 0.29
56 0.28
57 0.26
58 0.2
59 0.16
60 0.11
61 0.12
62 0.09
63 0.08
64 0.08
65 0.08
66 0.06
67 0.06
68 0.05
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.05
80 0.08
81 0.1
82 0.14
83 0.15
84 0.2
85 0.21
86 0.22
87 0.23
88 0.29
89 0.35
90 0.34
91 0.37
92 0.36
93 0.37
94 0.39
95 0.36
96 0.3
97 0.21
98 0.19
99 0.15
100 0.13
101 0.13
102 0.1
103 0.13
104 0.12
105 0.12
106 0.13
107 0.13
108 0.13
109 0.15
110 0.19
111 0.17
112 0.17
113 0.19
114 0.18
115 0.25
116 0.3
117 0.29
118 0.31
119 0.32
120 0.34
121 0.36
122 0.37
123 0.31
124 0.27
125 0.25
126 0.21
127 0.23
128 0.21
129 0.16
130 0.15
131 0.12
132 0.1
133 0.09
134 0.08
135 0.03
136 0.04
137 0.05
138 0.06
139 0.08
140 0.09
141 0.17
142 0.18
143 0.21