Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395RQP8

Protein Details
Accession A0A395RQP8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-111KSRSALIRWTKKKKAFFPRRNLPKGSPHydrophilic
NLS Segment(s)
PositionSequence
92-107RWTKKKKAFFPRRNLP
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MGFGCINLTPTASSESSRRVSLMEKWNDYFQRGTIHDFRRLCVDLDLPGDLPSKTKCRAAIKTVHVNINQFLDCDNKPDDVRFFKSRSALIRWTKKKKAFFPRRNLPKGSPLRTLLERMSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.25
4 0.25
5 0.24
6 0.21
7 0.23
8 0.29
9 0.37
10 0.38
11 0.39
12 0.41
13 0.47
14 0.47
15 0.46
16 0.38
17 0.3
18 0.29
19 0.26
20 0.3
21 0.32
22 0.34
23 0.39
24 0.39
25 0.38
26 0.37
27 0.37
28 0.32
29 0.25
30 0.22
31 0.16
32 0.17
33 0.17
34 0.12
35 0.12
36 0.12
37 0.1
38 0.11
39 0.12
40 0.14
41 0.15
42 0.17
43 0.21
44 0.26
45 0.3
46 0.33
47 0.38
48 0.39
49 0.46
50 0.47
51 0.46
52 0.4
53 0.38
54 0.34
55 0.29
56 0.24
57 0.15
58 0.14
59 0.13
60 0.12
61 0.15
62 0.15
63 0.15
64 0.15
65 0.17
66 0.2
67 0.22
68 0.28
69 0.29
70 0.29
71 0.31
72 0.33
73 0.35
74 0.35
75 0.36
76 0.38
77 0.43
78 0.52
79 0.59
80 0.66
81 0.72
82 0.75
83 0.78
84 0.8
85 0.82
86 0.83
87 0.83
88 0.84
89 0.86
90 0.89
91 0.88
92 0.84
93 0.76
94 0.76
95 0.75
96 0.7
97 0.66
98 0.59
99 0.57
100 0.55
101 0.54