Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395RKU2

Protein Details
Accession A0A395RKU2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MFAKPRPKKSILPPQYKKRKTTHHydrophilic
NLS Segment(s)
PositionSequence
6-10RPKKS
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences MFAKPRPKKSILPPQYKKRKTTHAVEEVNFDFDARQEYLTGFHKRKQQRIKNAQEEAAKRAHQEKLEMRKQACHDANMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.87
4 0.83
5 0.79
6 0.78
7 0.74
8 0.73
9 0.72
10 0.7
11 0.69
12 0.63
13 0.6
14 0.51
15 0.46
16 0.37
17 0.27
18 0.17
19 0.12
20 0.14
21 0.1
22 0.09
23 0.08
24 0.08
25 0.11
26 0.15
27 0.21
28 0.2
29 0.24
30 0.32
31 0.37
32 0.45
33 0.54
34 0.58
35 0.63
36 0.73
37 0.79
38 0.79
39 0.77
40 0.73
41 0.69
42 0.62
43 0.54
44 0.48
45 0.39
46 0.32
47 0.33
48 0.32
49 0.27
50 0.32
51 0.38
52 0.44
53 0.5
54 0.55
55 0.52
56 0.55
57 0.58
58 0.61
59 0.56