Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395RK15

Protein Details
Accession A0A395RK15    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-40KNRLAARASKARKDRRKKAEAPKDKVAKABasic
NLS Segment(s)
PositionSequence
12-79KNRLAARASKARKDRRKKAEAPKDKVAKADTTRGARKGLLPTSGPRAKMSAKKARKVEKRMAHAMKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPSVGNPNGPSKNRLAARASKARKDRRKKAEAPKDKVAKADTTRGARKGLLPTSGPRAKMSAKKARKVEKRMAHAMKRKMEADGEAEMKDAPEVETEEKTEEAEMADIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.44
4 0.5
5 0.57
6 0.59
7 0.59
8 0.66
9 0.72
10 0.77
11 0.8
12 0.82
13 0.82
14 0.86
15 0.87
16 0.89
17 0.89
18 0.89
19 0.86
20 0.85
21 0.82
22 0.73
23 0.66
24 0.56
25 0.51
26 0.43
27 0.42
28 0.38
29 0.36
30 0.39
31 0.38
32 0.37
33 0.32
34 0.32
35 0.3
36 0.26
37 0.23
38 0.2
39 0.2
40 0.27
41 0.29
42 0.26
43 0.22
44 0.22
45 0.24
46 0.29
47 0.35
48 0.38
49 0.42
50 0.49
51 0.55
52 0.63
53 0.68
54 0.7
55 0.71
56 0.69
57 0.69
58 0.72
59 0.73
60 0.71
61 0.71
62 0.71
63 0.67
64 0.63
65 0.57
66 0.49
67 0.42
68 0.35
69 0.3
70 0.26
71 0.22
72 0.18
73 0.18
74 0.16
75 0.15
76 0.13
77 0.11
78 0.07
79 0.07
80 0.1
81 0.12
82 0.14
83 0.15
84 0.17
85 0.17
86 0.17
87 0.16
88 0.13
89 0.11