Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395T6Q1

Protein Details
Accession A0A395T6Q1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
117-144LYNKKFRELWAKRQRERAKKRAMAKSEDHydrophilic
NLS Segment(s)
PositionSequence
123-138RELWAKRQRERAKKRA
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MCSPNSPGKSRLLVAENSVPKRSSGRICSKSGYGRNGWQLECRRSLSSHNSMLAHSDKEILNALSGIFREDSKPGETFESCQPEAESMEICDDKPSSASTHMSCDSGGEKKPVPFLLYNKKFRELWAKRQRERAKKRAMAKSEDTVMSDAIDTMMPDPMDTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.41
4 0.41
5 0.42
6 0.37
7 0.34
8 0.36
9 0.38
10 0.37
11 0.38
12 0.46
13 0.49
14 0.51
15 0.53
16 0.55
17 0.58
18 0.56
19 0.52
20 0.45
21 0.45
22 0.49
23 0.49
24 0.45
25 0.44
26 0.45
27 0.44
28 0.45
29 0.42
30 0.37
31 0.34
32 0.39
33 0.39
34 0.38
35 0.38
36 0.37
37 0.34
38 0.32
39 0.34
40 0.31
41 0.23
42 0.17
43 0.17
44 0.13
45 0.14
46 0.15
47 0.12
48 0.1
49 0.09
50 0.09
51 0.07
52 0.07
53 0.07
54 0.06
55 0.07
56 0.07
57 0.08
58 0.1
59 0.11
60 0.12
61 0.12
62 0.14
63 0.14
64 0.16
65 0.19
66 0.23
67 0.21
68 0.2
69 0.19
70 0.17
71 0.17
72 0.15
73 0.11
74 0.06
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.07
81 0.08
82 0.09
83 0.08
84 0.1
85 0.12
86 0.12
87 0.16
88 0.17
89 0.17
90 0.15
91 0.15
92 0.15
93 0.16
94 0.17
95 0.16
96 0.17
97 0.18
98 0.21
99 0.21
100 0.22
101 0.22
102 0.27
103 0.36
104 0.42
105 0.5
106 0.5
107 0.53
108 0.5
109 0.49
110 0.54
111 0.49
112 0.52
113 0.55
114 0.62
115 0.63
116 0.74
117 0.81
118 0.81
119 0.84
120 0.83
121 0.83
122 0.81
123 0.85
124 0.84
125 0.81
126 0.77
127 0.72
128 0.67
129 0.61
130 0.54
131 0.47
132 0.38
133 0.32
134 0.25
135 0.19
136 0.14
137 0.1
138 0.09
139 0.08
140 0.08
141 0.1
142 0.09
143 0.09