Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395STD0

Protein Details
Accession A0A395STD0   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-48EEQVDQEKPQRKTKTKKSKGERRKRRARFDDYDDEBasic
NLS Segment(s)
PositionSequence
21-41KPQRKTKTKKSKGERRKRRAR
Subcellular Location(s) nucl 22, cyto_nucl 13.833, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSSSSAEQRSDLEEEQVDQEKPQRKTKTKKSKGERRKRRARFDDYDDEQDNNQMAQSNYNAQQQQMQQQQMQQQQQQQMAQQQQQQGGGGKSDALSLHLELNLEIEIQLKARIHGDLTLCLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.25
4 0.22
5 0.19
6 0.25
7 0.31
8 0.35
9 0.43
10 0.49
11 0.55
12 0.65
13 0.76
14 0.8
15 0.82
16 0.88
17 0.9
18 0.91
19 0.93
20 0.94
21 0.94
22 0.93
23 0.94
24 0.93
25 0.93
26 0.91
27 0.89
28 0.84
29 0.81
30 0.79
31 0.72
32 0.68
33 0.59
34 0.5
35 0.41
36 0.35
37 0.27
38 0.18
39 0.14
40 0.1
41 0.09
42 0.09
43 0.09
44 0.11
45 0.13
46 0.17
47 0.17
48 0.15
49 0.18
50 0.18
51 0.24
52 0.26
53 0.26
54 0.23
55 0.26
56 0.32
57 0.34
58 0.37
59 0.33
60 0.33
61 0.35
62 0.37
63 0.35
64 0.31
65 0.31
66 0.32
67 0.32
68 0.31
69 0.3
70 0.29
71 0.29
72 0.28
73 0.25
74 0.21
75 0.18
76 0.14
77 0.12
78 0.1
79 0.11
80 0.1
81 0.09
82 0.09
83 0.1
84 0.11
85 0.11
86 0.11
87 0.1
88 0.11
89 0.09
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.11
96 0.1
97 0.11
98 0.13
99 0.14
100 0.14
101 0.17
102 0.19
103 0.18