Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395RL65

Protein Details
Accession A0A395RL65    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-109VDSVKKPSSGRIEKKRPDKRKQKSSKITFKSYGSHydrophilic
NLS Segment(s)
PositionSequence
80-120KKPSSGRIEKKRPDKRKQKSSKITFKSYGSRSKAKGKKKSA
Subcellular Location(s) mito 13.5, mito_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASTRKANNRRLVSNVFGPAEAARNERLSAKLLELAKQPKPESSDVNMNTQEEEAHESNEDAQEDETTMDVDSVKKPSSGRIEKKRPDKRKQKSSKITFKSYGSRSKAKGKKKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.72
4 0.66
5 0.6
6 0.55
7 0.49
8 0.4
9 0.34
10 0.31
11 0.25
12 0.23
13 0.2
14 0.17
15 0.15
16 0.15
17 0.16
18 0.17
19 0.18
20 0.17
21 0.17
22 0.16
23 0.19
24 0.18
25 0.2
26 0.24
27 0.27
28 0.28
29 0.31
30 0.31
31 0.28
32 0.32
33 0.31
34 0.3
35 0.29
36 0.33
37 0.31
38 0.34
39 0.32
40 0.29
41 0.27
42 0.23
43 0.19
44 0.11
45 0.15
46 0.11
47 0.1
48 0.1
49 0.1
50 0.1
51 0.11
52 0.11
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.08
65 0.1
66 0.1
67 0.12
68 0.12
69 0.18
70 0.27
71 0.36
72 0.44
73 0.52
74 0.62
75 0.69
76 0.8
77 0.85
78 0.86
79 0.87
80 0.89
81 0.89
82 0.9
83 0.92
84 0.92
85 0.93
86 0.93
87 0.93
88 0.89
89 0.87
90 0.8
91 0.74
92 0.72
93 0.67
94 0.66
95 0.62
96 0.62
97 0.59
98 0.65
99 0.68
100 0.7