Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395T649

Protein Details
Accession A0A395T649   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MVSAKKHVPIVKKRTKRFQRHQSDRFMRVGHydrophilic
NLS Segment(s)
PositionSequence
9-47PIVKKRTKRFQRHQSDRFMRVGESWRKPKGIDSRVRRRF
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFQRHQSDRFMRVGESWRKPKGIDSRVRRRFRGTIAMPSIGYGSNKKTRYMAPSGHKAFLVSNVADVELLIMHNRTHAAEIAHNVSSRKRVDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.89
4 0.9
5 0.9
6 0.91
7 0.92
8 0.9
9 0.9
10 0.87
11 0.8
12 0.72
13 0.63
14 0.52
15 0.44
16 0.45
17 0.43
18 0.44
19 0.46
20 0.46
21 0.46
22 0.46
23 0.5
24 0.51
25 0.52
26 0.53
27 0.56
28 0.64
29 0.73
30 0.78
31 0.72
32 0.68
33 0.62
34 0.57
35 0.56
36 0.48
37 0.46
38 0.43
39 0.42
40 0.36
41 0.32
42 0.29
43 0.2
44 0.18
45 0.12
46 0.13
47 0.19
48 0.2
49 0.21
50 0.22
51 0.23
52 0.27
53 0.3
54 0.33
55 0.31
56 0.38
57 0.4
58 0.39
59 0.37
60 0.32
61 0.28
62 0.24
63 0.22
64 0.12
65 0.11
66 0.1
67 0.1
68 0.09
69 0.09
70 0.07
71 0.04
72 0.04
73 0.04
74 0.05
75 0.04
76 0.05
77 0.06
78 0.06
79 0.07
80 0.09
81 0.1
82 0.11
83 0.14
84 0.16
85 0.17
86 0.18
87 0.18
88 0.19
89 0.23
90 0.23
91 0.22
92 0.21
93 0.23
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47