Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395RKP0

Protein Details
Accession A0A395RKP0    Localization Confidence High Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40EKGTDFKKLKLLKKQKEAEKRNAAARKBasic
397-418KAGGRVSKSRPGKARRKAMGSRBasic
NLS Segment(s)
PositionSequence
20-40KKLKLLKKQKEAEKRNAAARK
273-318KKAAQEARKLRDLKKFGKQVQVAKLQERQKEKRETLDKIKNLKRKR
348-379RSGAGRGAGGNHKRAKKDEKYGFGGKKRHAKS
393-418PKKMKAGGRVSKSRPGKARRKAMGSR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008610  Ebp2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF05890  Ebp2  
Amino Acid Sequences MVTKSKLKMALAAEKGTDFKKLKLLKKQKEAEKRNAAARKTVDKDSDEEKEKKTIQIEADFEDEDDEDENEDEDEDEEETQYDLNGINDSDDSDSSIELEEKIIRKPKRDTLKKSELAQLAAEKAAAAAAEEDDEEEDPEADDIPMSDLEDLEEEDKEDIIPHQRLTINNTTALLAALNRISVPTDSSVPFATHQCLVSSSATAESIPDVQDDLQRELAFYTQSLEATRTARKLLRQEGVPFSRPKDYFAEMIKEDAHMEKVKAKLVEEASNKKAAQEARKLRDLKKFGKQVQVAKLQERQKEKRETLDKIKNLKRKRSETGGAGLDTKEADIFDVGVEKEMKSHNSRSGAGRGAGGNHKRAKKDEKYGFGGKKRHAKSGDAMSSGDLSGFDPKKMKAGGRVSKSRPGKARRKAMGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.33
4 0.35
5 0.28
6 0.26
7 0.33
8 0.41
9 0.48
10 0.56
11 0.67
12 0.68
13 0.77
14 0.84
15 0.85
16 0.88
17 0.88
18 0.87
19 0.87
20 0.82
21 0.81
22 0.79
23 0.7
24 0.67
25 0.64
26 0.62
27 0.57
28 0.58
29 0.53
30 0.48
31 0.5
32 0.48
33 0.5
34 0.48
35 0.48
36 0.45
37 0.47
38 0.47
39 0.48
40 0.44
41 0.42
42 0.39
43 0.4
44 0.4
45 0.35
46 0.35
47 0.31
48 0.29
49 0.24
50 0.19
51 0.14
52 0.13
53 0.1
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.06
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.09
77 0.1
78 0.09
79 0.1
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.08
86 0.09
87 0.12
88 0.13
89 0.18
90 0.26
91 0.28
92 0.34
93 0.4
94 0.47
95 0.55
96 0.64
97 0.68
98 0.69
99 0.77
100 0.77
101 0.74
102 0.73
103 0.64
104 0.55
105 0.47
106 0.39
107 0.29
108 0.24
109 0.2
110 0.12
111 0.09
112 0.08
113 0.06
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.06
123 0.05
124 0.06
125 0.05
126 0.06
127 0.06
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.05
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.07
147 0.12
148 0.13
149 0.13
150 0.16
151 0.18
152 0.19
153 0.25
154 0.3
155 0.26
156 0.26
157 0.26
158 0.23
159 0.2
160 0.19
161 0.13
162 0.07
163 0.06
164 0.06
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.06
171 0.07
172 0.09
173 0.09
174 0.11
175 0.11
176 0.11
177 0.12
178 0.12
179 0.13
180 0.12
181 0.11
182 0.11
183 0.11
184 0.12
185 0.11
186 0.11
187 0.09
188 0.08
189 0.08
190 0.08
191 0.07
192 0.05
193 0.06
194 0.06
195 0.05
196 0.05
197 0.06
198 0.08
199 0.1
200 0.11
201 0.12
202 0.11
203 0.11
204 0.11
205 0.11
206 0.09
207 0.07
208 0.08
209 0.07
210 0.07
211 0.08
212 0.09
213 0.1
214 0.12
215 0.14
216 0.13
217 0.15
218 0.17
219 0.2
220 0.25
221 0.29
222 0.3
223 0.31
224 0.34
225 0.38
226 0.4
227 0.4
228 0.36
229 0.32
230 0.36
231 0.34
232 0.33
233 0.3
234 0.28
235 0.27
236 0.28
237 0.3
238 0.23
239 0.24
240 0.21
241 0.18
242 0.17
243 0.14
244 0.14
245 0.11
246 0.12
247 0.15
248 0.16
249 0.19
250 0.19
251 0.19
252 0.21
253 0.23
254 0.29
255 0.3
256 0.34
257 0.33
258 0.37
259 0.36
260 0.32
261 0.33
262 0.3
263 0.32
264 0.36
265 0.43
266 0.44
267 0.52
268 0.56
269 0.57
270 0.62
271 0.62
272 0.59
273 0.59
274 0.63
275 0.6
276 0.65
277 0.65
278 0.62
279 0.63
280 0.65
281 0.58
282 0.54
283 0.56
284 0.53
285 0.54
286 0.57
287 0.56
288 0.56
289 0.63
290 0.61
291 0.63
292 0.65
293 0.66
294 0.67
295 0.7
296 0.68
297 0.69
298 0.75
299 0.74
300 0.75
301 0.78
302 0.77
303 0.75
304 0.75
305 0.73
306 0.7
307 0.66
308 0.64
309 0.57
310 0.48
311 0.42
312 0.35
313 0.27
314 0.22
315 0.18
316 0.11
317 0.08
318 0.07
319 0.06
320 0.06
321 0.06
322 0.08
323 0.08
324 0.1
325 0.11
326 0.1
327 0.13
328 0.16
329 0.2
330 0.23
331 0.27
332 0.31
333 0.35
334 0.38
335 0.4
336 0.42
337 0.41
338 0.37
339 0.35
340 0.3
341 0.29
342 0.35
343 0.35
344 0.37
345 0.41
346 0.46
347 0.47
348 0.54
349 0.59
350 0.6
351 0.66
352 0.68
353 0.67
354 0.69
355 0.75
356 0.77
357 0.75
358 0.73
359 0.7
360 0.72
361 0.67
362 0.69
363 0.63
364 0.59
365 0.58
366 0.61
367 0.59
368 0.51
369 0.48
370 0.4
371 0.38
372 0.33
373 0.26
374 0.16
375 0.11
376 0.18
377 0.19
378 0.21
379 0.23
380 0.24
381 0.29
382 0.33
383 0.35
384 0.36
385 0.45
386 0.52
387 0.57
388 0.66
389 0.66
390 0.72
391 0.75
392 0.75
393 0.74
394 0.75
395 0.77
396 0.77
397 0.83
398 0.82