Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395T8Q0

Protein Details
Accession A0A395T8Q0   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
81-105EELKLRGKSAPKKKKGPPAPTGKKRBasic
NLS Segment(s)
PositionSequence
85-105LRGKSAPKKKKGPPAPTGKKR
Subcellular Location(s) mito 16.5, cyto_mito 12, cyto 6.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRARILDLMKAQCQVFATSYNPDGVRMGNKILRQRLRGPAMAAYYPRKTATIQDLKREFGPTLATWDEAEEDRFEYIEELKLRGKSAPKKKKGPPAPTGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.32
4 0.25
5 0.19
6 0.18
7 0.18
8 0.18
9 0.19
10 0.2
11 0.19
12 0.18
13 0.18
14 0.16
15 0.17
16 0.15
17 0.18
18 0.18
19 0.21
20 0.26
21 0.34
22 0.37
23 0.38
24 0.42
25 0.46
26 0.47
27 0.45
28 0.4
29 0.35
30 0.32
31 0.29
32 0.26
33 0.22
34 0.2
35 0.19
36 0.19
37 0.17
38 0.15
39 0.17
40 0.23
41 0.29
42 0.3
43 0.37
44 0.38
45 0.38
46 0.39
47 0.38
48 0.29
49 0.2
50 0.21
51 0.13
52 0.16
53 0.15
54 0.15
55 0.13
56 0.13
57 0.14
58 0.12
59 0.13
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.09
67 0.13
68 0.13
69 0.15
70 0.18
71 0.2
72 0.21
73 0.24
74 0.32
75 0.37
76 0.47
77 0.56
78 0.62
79 0.7
80 0.78
81 0.85
82 0.87
83 0.86
84 0.85
85 0.85