Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LED0

Protein Details
Accession E2LED0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MDTGRLRVSKKRNRSKRQDPFVHCPYIHydrophilic
NLS Segment(s)
PositionSequence
10-14KKRNR
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
KEGG mpr:MPER_04680  -  
Amino Acid Sequences MDTGRLRVSKKRNRSKRQDPFVHCPYIYTTPEFESERKFEHIFRDHFFFFPSYDFRNRIQPFFCISTYLHTGFITLHFNWYYNLRWITEFPDRRLIVCTTSFIDNSKRKYDLDPNLNLNLGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.93
4 0.93
5 0.93
6 0.9
7 0.88
8 0.83
9 0.78
10 0.66
11 0.56
12 0.5
13 0.46
14 0.39
15 0.32
16 0.28
17 0.24
18 0.27
19 0.28
20 0.25
21 0.23
22 0.23
23 0.24
24 0.26
25 0.26
26 0.24
27 0.29
28 0.35
29 0.34
30 0.34
31 0.36
32 0.33
33 0.32
34 0.32
35 0.25
36 0.18
37 0.17
38 0.17
39 0.16
40 0.18
41 0.21
42 0.21
43 0.3
44 0.3
45 0.31
46 0.29
47 0.27
48 0.27
49 0.27
50 0.26
51 0.18
52 0.17
53 0.18
54 0.2
55 0.2
56 0.17
57 0.14
58 0.14
59 0.12
60 0.14
61 0.14
62 0.11
63 0.13
64 0.12
65 0.13
66 0.13
67 0.15
68 0.16
69 0.17
70 0.19
71 0.17
72 0.18
73 0.19
74 0.23
75 0.31
76 0.33
77 0.31
78 0.39
79 0.38
80 0.38
81 0.4
82 0.36
83 0.3
84 0.27
85 0.26
86 0.2
87 0.22
88 0.21
89 0.2
90 0.28
91 0.31
92 0.35
93 0.38
94 0.38
95 0.37
96 0.43
97 0.51
98 0.52
99 0.54
100 0.56
101 0.55
102 0.55