Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395T468

Protein Details
Accession A0A395T468   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
167-200PSDIYAREKRRRKQDKRDRERAKRGKKTSRHVGEBasic
362-390RELERERAREERRARRAQREYRRGRTTEEBasic
NLS Segment(s)
PositionSequence
173-196REKRRRKQDKRDRERAKRGKKTSR
291-301RMRAEARRLRE
367-384ERAREERRARRAQREYRR
Subcellular Location(s) mito 8, cyto 5.5, cyto_nucl 5, golg 4, nucl 3.5, vacu 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPAIIRTLRIAPSLTQHAPRAAEAFSTLSGHLLEASKVLYARDDKNDDDKNDRHKPSVEPESGSFDPHNINNAGFFFLFALIGVGFVCTGIWFFFWAKNGGFQFKETDWDDYKSTVLRRTGPNGTILSNATRPTNLGGGSVYKDVDDDNTTVVTESTTLTGITAGPSDIYAREKRRRKQDKRDRERAKRGKKTSRHVGEEGVEDEEAERAAKKELRNYRHERAARVGGLNKESEGSEWDGSTNNGTESNVSTNLLSDRQTTPTTTPTKAKGGIRKVYSTADRRENREAERMRAEARRLREAGRNARRDFSYQRAESYSRADTAADSQVSESLLSGTQLTRITDDSGDLGTKSYHHPMPELRELERERAREERRARRAQREYRRGRTTEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.35
4 0.36
5 0.38
6 0.38
7 0.37
8 0.33
9 0.26
10 0.22
11 0.19
12 0.18
13 0.15
14 0.15
15 0.14
16 0.13
17 0.13
18 0.12
19 0.12
20 0.12
21 0.11
22 0.1
23 0.1
24 0.11
25 0.11
26 0.11
27 0.14
28 0.18
29 0.22
30 0.29
31 0.32
32 0.34
33 0.42
34 0.49
35 0.48
36 0.51
37 0.52
38 0.54
39 0.6
40 0.6
41 0.56
42 0.52
43 0.53
44 0.55
45 0.58
46 0.52
47 0.46
48 0.45
49 0.48
50 0.45
51 0.43
52 0.34
53 0.26
54 0.26
55 0.24
56 0.26
57 0.19
58 0.19
59 0.18
60 0.19
61 0.19
62 0.15
63 0.15
64 0.11
65 0.1
66 0.1
67 0.08
68 0.08
69 0.05
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.03
77 0.04
78 0.04
79 0.04
80 0.06
81 0.07
82 0.1
83 0.12
84 0.14
85 0.14
86 0.2
87 0.21
88 0.24
89 0.23
90 0.22
91 0.24
92 0.22
93 0.27
94 0.23
95 0.26
96 0.25
97 0.27
98 0.27
99 0.24
100 0.24
101 0.23
102 0.23
103 0.23
104 0.24
105 0.26
106 0.29
107 0.33
108 0.37
109 0.35
110 0.36
111 0.32
112 0.3
113 0.27
114 0.24
115 0.21
116 0.18
117 0.18
118 0.15
119 0.14
120 0.14
121 0.13
122 0.14
123 0.12
124 0.1
125 0.1
126 0.11
127 0.12
128 0.12
129 0.11
130 0.09
131 0.09
132 0.09
133 0.1
134 0.1
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.07
142 0.06
143 0.06
144 0.05
145 0.06
146 0.05
147 0.05
148 0.06
149 0.06
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.05
156 0.06
157 0.09
158 0.14
159 0.21
160 0.3
161 0.39
162 0.45
163 0.56
164 0.67
165 0.73
166 0.8
167 0.84
168 0.86
169 0.88
170 0.93
171 0.92
172 0.91
173 0.92
174 0.91
175 0.9
176 0.88
177 0.87
178 0.86
179 0.84
180 0.82
181 0.81
182 0.78
183 0.72
184 0.64
185 0.57
186 0.48
187 0.41
188 0.34
189 0.24
190 0.17
191 0.11
192 0.1
193 0.08
194 0.06
195 0.05
196 0.05
197 0.04
198 0.07
199 0.11
200 0.12
201 0.2
202 0.28
203 0.34
204 0.43
205 0.5
206 0.53
207 0.58
208 0.59
209 0.53
210 0.5
211 0.48
212 0.41
213 0.36
214 0.34
215 0.27
216 0.27
217 0.24
218 0.2
219 0.16
220 0.15
221 0.13
222 0.11
223 0.12
224 0.1
225 0.1
226 0.11
227 0.11
228 0.11
229 0.11
230 0.1
231 0.07
232 0.08
233 0.08
234 0.08
235 0.09
236 0.11
237 0.11
238 0.11
239 0.1
240 0.1
241 0.12
242 0.12
243 0.12
244 0.12
245 0.13
246 0.16
247 0.17
248 0.18
249 0.19
250 0.25
251 0.28
252 0.28
253 0.3
254 0.3
255 0.34
256 0.37
257 0.41
258 0.42
259 0.46
260 0.5
261 0.49
262 0.48
263 0.46
264 0.46
265 0.47
266 0.45
267 0.43
268 0.46
269 0.48
270 0.51
271 0.56
272 0.56
273 0.52
274 0.56
275 0.53
276 0.48
277 0.48
278 0.44
279 0.41
280 0.41
281 0.43
282 0.39
283 0.4
284 0.42
285 0.4
286 0.41
287 0.44
288 0.49
289 0.54
290 0.59
291 0.63
292 0.58
293 0.6
294 0.59
295 0.56
296 0.53
297 0.5
298 0.5
299 0.42
300 0.43
301 0.43
302 0.43
303 0.4
304 0.4
305 0.34
306 0.26
307 0.25
308 0.23
309 0.19
310 0.2
311 0.24
312 0.19
313 0.16
314 0.16
315 0.16
316 0.16
317 0.15
318 0.12
319 0.08
320 0.08
321 0.08
322 0.09
323 0.08
324 0.11
325 0.13
326 0.14
327 0.14
328 0.15
329 0.17
330 0.16
331 0.17
332 0.15
333 0.14
334 0.14
335 0.13
336 0.12
337 0.11
338 0.12
339 0.15
340 0.2
341 0.22
342 0.22
343 0.26
344 0.31
345 0.38
346 0.45
347 0.45
348 0.41
349 0.46
350 0.48
351 0.53
352 0.54
353 0.48
354 0.43
355 0.5
356 0.53
357 0.54
358 0.62
359 0.64
360 0.68
361 0.76
362 0.8
363 0.82
364 0.87
365 0.89
366 0.9
367 0.9
368 0.9
369 0.9
370 0.9
371 0.82