Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LB74

Protein Details
Accession E2LB74    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-25KEITSAKKKGKSPLKQYRNIQLHGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 10.5, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029035  DHS-like_NAD/FAD-binding_dom  
IPR003000  Sirtuin  
IPR026590  Ssirtuin_cat_dom  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0070403  F:NAD+ binding  
GO:0016740  F:transferase activity  
KEGG mpr:MPER_03378  -  
Pfam View protein in Pfam  
PF02146  SIR2  
PROSITE View protein in PROSITE  
PS50305  SIRTUIN  
Amino Acid Sequences MKEITSAKKKGKSPLKQYRNIQLHGDIHRVRCRTCSAEFPCLEEYLILFEEGQCPDCPECLQRSRSRVARSARAIRVGQLRPAIVLYDEFHPLGDDIGNVQCSDLARKPDMLIIMGTSLKVHGLKKLVKEFAKAVHAHAPSGSANTSRSKSWAGKVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.83
4 0.84
5 0.85
6 0.81
7 0.74
8 0.66
9 0.61
10 0.57
11 0.51
12 0.53
13 0.45
14 0.43
15 0.47
16 0.46
17 0.4
18 0.37
19 0.39
20 0.35
21 0.34
22 0.39
23 0.38
24 0.44
25 0.44
26 0.44
27 0.41
28 0.37
29 0.34
30 0.24
31 0.19
32 0.12
33 0.12
34 0.09
35 0.07
36 0.07
37 0.1
38 0.1
39 0.12
40 0.09
41 0.11
42 0.11
43 0.12
44 0.13
45 0.13
46 0.17
47 0.21
48 0.26
49 0.29
50 0.33
51 0.38
52 0.43
53 0.44
54 0.46
55 0.45
56 0.47
57 0.49
58 0.52
59 0.47
60 0.46
61 0.43
62 0.39
63 0.41
64 0.34
65 0.3
66 0.24
67 0.22
68 0.18
69 0.18
70 0.15
71 0.08
72 0.08
73 0.07
74 0.08
75 0.09
76 0.09
77 0.08
78 0.09
79 0.08
80 0.08
81 0.07
82 0.05
83 0.05
84 0.06
85 0.07
86 0.06
87 0.06
88 0.07
89 0.07
90 0.11
91 0.13
92 0.15
93 0.16
94 0.17
95 0.18
96 0.19
97 0.19
98 0.16
99 0.13
100 0.1
101 0.1
102 0.1
103 0.09
104 0.07
105 0.07
106 0.08
107 0.1
108 0.1
109 0.13
110 0.19
111 0.23
112 0.29
113 0.36
114 0.42
115 0.41
116 0.43
117 0.42
118 0.41
119 0.44
120 0.38
121 0.34
122 0.34
123 0.33
124 0.31
125 0.28
126 0.26
127 0.2
128 0.22
129 0.2
130 0.14
131 0.16
132 0.21
133 0.24
134 0.22
135 0.25
136 0.29
137 0.32