Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395T428

Protein Details
Accession A0A395T428    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
134-163KDVSDKEAAKNRKPKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
140-155EAAKNRKPKKKAKKIK
Subcellular Location(s) cyto_nucl 13.333, nucl 12.5, cyto 12, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPTPKINSKNLSYDNSAPPFLAALRAQAAGATGPDPLLAAQRRSAKKRSSSEEAEDVPLVVDEDGNVVSLEVDKDGVVKDTGDYDLESAAEKETTKEPESKTTIGGRKRKVGKVVGGDSDEAKAEGDGEDKTKDVSDKEAAKNRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.51
4 0.46
5 0.38
6 0.32
7 0.28
8 0.23
9 0.21
10 0.13
11 0.12
12 0.13
13 0.13
14 0.13
15 0.12
16 0.12
17 0.09
18 0.09
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.11
26 0.12
27 0.13
28 0.18
29 0.27
30 0.34
31 0.39
32 0.45
33 0.46
34 0.53
35 0.59
36 0.62
37 0.61
38 0.59
39 0.58
40 0.56
41 0.5
42 0.43
43 0.35
44 0.28
45 0.21
46 0.16
47 0.12
48 0.07
49 0.05
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.09
82 0.12
83 0.14
84 0.18
85 0.19
86 0.25
87 0.29
88 0.28
89 0.28
90 0.32
91 0.36
92 0.4
93 0.46
94 0.44
95 0.48
96 0.55
97 0.56
98 0.55
99 0.54
100 0.51
101 0.51
102 0.51
103 0.45
104 0.39
105 0.36
106 0.31
107 0.27
108 0.21
109 0.14
110 0.11
111 0.08
112 0.07
113 0.06
114 0.07
115 0.07
116 0.09
117 0.1
118 0.1
119 0.11
120 0.12
121 0.13
122 0.13
123 0.16
124 0.21
125 0.28
126 0.35
127 0.44
128 0.49
129 0.57
130 0.66
131 0.71
132 0.76
133 0.78
134 0.81
135 0.83
136 0.88
137 0.91
138 0.92
139 0.93
140 0.92
141 0.94
142 0.93
143 0.9