Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395RSM4

Protein Details
Accession A0A395RSM4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVSAKKHVPIVKKRTKRFERHQSDRFDCVHydrophilic
NLS Segment(s)
PositionSequence
12-17KKRTKR
34-46RKPKGIDSRVRRR
Subcellular Location(s) mito 14.5, mito_nucl 12.333, nucl 9, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFERHQSDRFDCVKASWRKPKGIDSRVRRRFRGTIAMPSIGYGSNKKTRYMAPSGHKAFLVHNENDVNLLLMHNRTHAAEIAHNVSSRKRVNIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.88
4 0.88
5 0.89
6 0.89
7 0.89
8 0.87
9 0.86
10 0.8
11 0.78
12 0.69
13 0.6
14 0.5
15 0.42
16 0.44
17 0.43
18 0.47
19 0.49
20 0.52
21 0.56
22 0.58
23 0.65
24 0.66
25 0.66
26 0.67
27 0.67
28 0.73
29 0.78
30 0.8
31 0.72
32 0.68
33 0.62
34 0.57
35 0.56
36 0.48
37 0.46
38 0.43
39 0.42
40 0.36
41 0.32
42 0.29
43 0.2
44 0.18
45 0.12
46 0.13
47 0.19
48 0.2
49 0.21
50 0.22
51 0.23
52 0.27
53 0.3
54 0.33
55 0.31
56 0.38
57 0.4
58 0.39
59 0.37
60 0.33
61 0.29
62 0.3
63 0.3
64 0.21
65 0.21
66 0.2
67 0.2
68 0.2
69 0.19
70 0.13
71 0.08
72 0.07
73 0.06
74 0.07
75 0.08
76 0.08
77 0.08
78 0.08
79 0.09
80 0.11
81 0.11
82 0.12
83 0.14
84 0.16
85 0.17
86 0.18
87 0.18
88 0.19
89 0.24
90 0.25
91 0.25
92 0.25
93 0.3
94 0.36
95 0.45
96 0.52
97 0.53
98 0.57
99 0.57
100 0.55
101 0.51
102 0.46
103 0.43
104 0.37
105 0.35
106 0.38
107 0.44
108 0.5
109 0.49
110 0.5
111 0.47