Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395SN66

Protein Details
Accession A0A395SN66    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
71-95SPSPAAKKTPGRKRGPKPKTPKTVGBasic
101-125GDYGSPKKSTPRKRRAPKAEVDDETHydrophilic
NLS Segment(s)
PositionSequence
75-92AAKKTPGRKRGPKPKTPK
107-118KKSTPRKRRAPK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences MSDFSTPKTNAWTDEAKNELLLRIIAQLKPEGKSINWNEINMEGRTMKSLQNQWTAFNKKIDALKQQSADSPSPAAKKTPGRKRGPKPKTPKTVGSDDDDGDYGSPKKSTPRKRRAPKAEVDDETPESSAKAIKLELNETIKAEDEEDYGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.32
4 0.31
5 0.29
6 0.25
7 0.19
8 0.17
9 0.12
10 0.14
11 0.16
12 0.16
13 0.17
14 0.21
15 0.22
16 0.23
17 0.25
18 0.22
19 0.19
20 0.28
21 0.3
22 0.35
23 0.35
24 0.34
25 0.33
26 0.33
27 0.36
28 0.27
29 0.26
30 0.16
31 0.14
32 0.16
33 0.17
34 0.16
35 0.18
36 0.24
37 0.26
38 0.33
39 0.34
40 0.35
41 0.42
42 0.44
43 0.41
44 0.37
45 0.34
46 0.29
47 0.32
48 0.31
49 0.31
50 0.31
51 0.33
52 0.33
53 0.33
54 0.32
55 0.32
56 0.3
57 0.23
58 0.19
59 0.17
60 0.17
61 0.17
62 0.16
63 0.16
64 0.23
65 0.32
66 0.4
67 0.48
68 0.55
69 0.64
70 0.74
71 0.81
72 0.82
73 0.82
74 0.83
75 0.83
76 0.84
77 0.79
78 0.77
79 0.7
80 0.68
81 0.61
82 0.55
83 0.48
84 0.38
85 0.34
86 0.27
87 0.21
88 0.15
89 0.14
90 0.11
91 0.09
92 0.09
93 0.09
94 0.18
95 0.27
96 0.38
97 0.48
98 0.58
99 0.68
100 0.78
101 0.89
102 0.91
103 0.89
104 0.87
105 0.85
106 0.83
107 0.74
108 0.67
109 0.6
110 0.52
111 0.46
112 0.37
113 0.28
114 0.19
115 0.17
116 0.16
117 0.12
118 0.11
119 0.12
120 0.14
121 0.17
122 0.19
123 0.25
124 0.26
125 0.27
126 0.27
127 0.26
128 0.25
129 0.23
130 0.22
131 0.17